SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2XLY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2XLY6
Domain Number 1 Region: 90-220
Classification Level Classification E-value
Superfamily Cullin homology domain 2.75e-22
Family Cullin homology domain 0.00044
Further Details:      
 
Domain Number 2 Region: 219-283
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000907
Family SCF ubiquitin ligase complex WHB domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2XLY6
Sequence length 297
Comment (tr|A0A0C2XLY6|A0A0C2XLY6_AMAMU) Uncharacterized protein {ECO:0000313|EMBL:KIL70521.1} KW=Complete proteome; Reference proteome OX=946122 OS=Amanita muscaria Koide BX008. GN=M378DRAFT_175700 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Amanitaceae; Amanita.
Sequence
MVSSVNSDDENSSSGQQVISKPSRTLWRKLRAVIEIRGLRIVQKSQALQDELIDKVSGRD
GRGYVLFTAYSHQTKQKLAVSNTPTSYSACSRDLTDFFKVRMAANHPDDQDITFSIMVLG
TNFWPLNLPTHDFVILTEIATTYYLFRKYYQTKHSGRKLVHDTLSLEEIQAATAVSKDIL
FQMLALLVKAKVLINEGNDQYDLNPNYKSKKIRVNLNQPIKAEVKAESSDVLKAVHGDRK
YVIQATIVRIMKARKTLKNQPLIQEVIPQISQRFAPKIPDVKKASYPVNLSNVRADG
Download sequence
Identical sequences A0A0C2XLY6
jgi|Amamu1|175700|fgenesh1_pg.3_#_327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]