SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2ZEM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2ZEM9
Domain Number 1 Region: 12-77
Classification Level Classification E-value
Superfamily PAZ domain 0.000000612
Family PAZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2ZEM9
Sequence length 77
Comment (tr|A0A0C2ZEM9|A0A0C2ZEM9_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM51392.1} KW=Complete proteome; Reference proteome OX=1036808 OS=Scleroderma citrinum Foug A. GN=SCLCIDRAFT_33483 OC=Sclerodermataceae; Scleroderma.
Sequence
MTLHFTSGYHPEGDGQTNVMHQICLNVFIGLKHLELRKRKIADIIPCTGYYEFKKDSDAN
DMTVQKYYRETYNIHIK
Download sequence
Identical sequences A0A0C2ZEM9
jgi|Sclci1|33483|gm1.14938_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]