SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2ZQA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C2ZQA4
Domain Number - Region: 26-102
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0369
Family Poly(A) polymerase, PAP, middle domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2ZQA4
Sequence length 111
Comment (tr|A0A0C2ZQA4|A0A0C2ZQA4_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM54787.1} KW=Complete proteome; Reference proteome OX=1036808 OS=Scleroderma citrinum Foug A. GN=SCLCIDRAFT_30835 OC=Sclerodermataceae; Scleroderma.
Sequence
MGKTKLCIVKSFFCDTLGDPQLTMEILCTLMENLHTPMENLHPTLEILCTPMENLHTLMK
NLHPTLENLCTPMEILHPTLKNLCTTLEILHPTLEILCTPMENLHTTMDNS
Download sequence
Identical sequences A0A0C2ZQA4
jgi|Sclci1|30835|gm1.12290_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]