SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3A4L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3A4L4
Domain Number 1 Region: 68-127
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000000000017
Family DEK C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3A4L4
Sequence length 170
Comment (tr|A0A0C3A4L4|A0A0C3A4L4_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM59637.1} KW=Complete proteome; Reference proteome OX=1036808 OS=Scleroderma citrinum Foug A. GN=SCLCIDRAFT_1217586 OC=Sclerodermataceae; Scleroderma.
Sequence
MYYEPRSQSPVPLQFGVLPPGYQSGRNTPLSAGHMQPMSDIGLLPQPGLSRPPTTYLDMP
IPLTQEMDLTSGTPNDADLKRTVQDILWMADLNTVTEREICHQLKEHLSMDLTARKAMIN
AAIDHTLLADRDMRALSFFWTMMDETLWMYIGLWTKLLMLCTHARERNFH
Download sequence
Identical sequences A0A0C3A4L4
jgi|Sclci1|1217586|fgenesh1_kg.68_#_65_#_Locus5197v2rpkm3.08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]