SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3AEH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3AEH9
Domain Number - Region: 5-39
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0259
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3AEH9
Sequence length 188
Comment (tr|A0A0C3AEH9|A0A0C3AEH9_RHOER) Uncharacterized protein {ECO:0000313|EMBL:KIM17696.1} KW=Complete proteome OX=1833 OS=Rhodococcus erythropolis (Arthrobacter picolinophilus). GN=QV65_03010 OC=Rhodococcus.
Sequence
MSDQNWGPGQPSQNPPYGQMPPMPPQGYQPPTPAYPFASWISRVFASILDGFVVPLPGVI
LAGIGAVIAFSGSEVTTYDDGSVSAEGGNPVGVIVMVVGILAIFLIEVWNLVFRQGNTGQ
TLGKKWLGISVIRESDGVPLGPVMALLRWIMMAILGGACFLNYLWPLWDSKHQCWHDMVV
RSVVVRAR
Download sequence
Identical sequences A0A0C3AEH9 C0ZNH1 T5HLG4
WP_020905988.1.2937 WP_020905988.1.3298 WP_020905988.1.40047 WP_020905988.1.58082 WP_020905988.1.61491 WP_020905988.1.61677 WP_020905988.1.79292 WP_020905988.1.83724 gi|532362698|ref|YP_008451097.1| 234621.RER_05150 gi|226304004|ref|YP_002763962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]