SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3B456 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3B456
Domain Number 1 Region: 173-242
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000785
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3B456
Sequence length 287
Comment (tr|A0A0C3B456|A0A0C3B456_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM26271.1} KW=Complete proteome; Reference proteome OX=933852 OS=Serendipita vermifera MAFF 305830. GN=M408DRAFT_330654 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence
MSFPRDSSVFNKFRFASLPVELFYEIHIYARNPNLPIASKHIYMTLSNAPRSVKALYILN
IWTSYPTIGEYLVRGGLNRILKYPICTREVIEYCFTLLVPPYHLRPPNNWTEPPPWRPTI
TIKMTFSIPSRLIYDIAQPSTRKNAAAFVEYLCNLPPVYCQRLPDRLERGILVLCPIGNS
EKPLVTAIEARSISLVRSLLRCGMHPGSRNNAPVRAAIEQRDLALVKLVIDGDMEPMVTS
KGDEMPDLHEYQRISVPVDRSMLKRAIKMQAKDIVEWFIKDKGLTLP
Download sequence
Identical sequences A0A0C3B456
jgi|Sebve1|330654|fgenesh1_kg.31_#_26_#_Locus5727v2rpkm9.04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]