SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3BI57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3BI57
Domain Number - Region: 33-53
Classification Level Classification E-value
Superfamily FnI-like domain 0.0199
Family Fibronectin type I module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3BI57
Sequence length 54
Comment (tr|A0A0C3BI57|A0A0C3BI57_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM85993.1} KW=Complete proteome; Reference proteome OX=765440 OS=Piloderma croceum F 1598. GN=PILCRDRAFT_816535 OC=Agaricomycetes; Agaricomycetidae; Atheliales; Atheliaceae; Piloderma.
Sequence
MDRSGDKCLYITNPFPRFTEASHHRKSISGSGDSRDTWEEPNDRGTRAEECQCQ
Download sequence
Identical sequences A0A0C3BI57
jgi|Pilcr1|816535|fgenesh1_kg.00014_#_88_#_Locus13179v4rpkm0.21_PRE

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]