SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3CB41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3CB41
Domain Number 1 Region: 181-254,284-335
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.58e-28
Family cAMP-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 342-472
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.76e-22
Family cAMP-binding domain 0.00031
Further Details:      
 
Weak hits

Sequence:  A0A0C3CB41
Domain Number - Region: 4-38
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 
Domain Number - Region: 124-209
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 0.0549
Family Creatinase/aminopeptidase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3CB41
Sequence length 492
Comment (tr|A0A0C3CB41|A0A0C3CB41_HEBCY) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=686832 OS=Hebeloma cylindrosporum h7. GN=M413DRAFT_441091 OC=Hebeloma.
Sequence
MSSTFDSLVSDLTRDAQRVQPKDALQFCANWFQSRLEEQRARTRDLLASRAQSLSAPSEL
YSDSGLGSSSTGPPTLAPFPRPRSSIRDSIAHSPFGTLNVPGNALLGGDRTPPSLRYNQN
ELPPTSPLSNVNPFAAFDTATPTPLNPGDYLHAPSSAIFARRTSVSAESIAVDSTSDEPM
PVHPKTEDQIRRIKAAIGNNLIFRDLDEEQETGVLNAMQERKVAKHEVVIRQGDVGEYFY
VVESGMLHCFIRPEPLPPAWLSAGNVASSVSGEDKFVSPKYHPEFGRNVLECKPGSSFGE
LALMYGHPRAATVLAMEASTLWSLDRITFRTIILKAAHRRRTMYEQFLSTVTLLSSLDAA
ERSKIADALVSSVYLDGEAVVRQGEMGDTFFFIEEGEAIVTKTQQTENGDVREVKVGHLR
KGDYFGELSLLRLAPRAATVSAIYRTDPLSPKLKVAALDEAAFPRLLGPLREIMERKAGE
SYGSGPRPSMSR
Download sequence
Identical sequences A0A0C3CB41
jgi|Hebcy2|441091|fgenesh1_kg.4_#_293_#_Locus2085v1rpkm33.30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]