SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3CPA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3CPA5
Domain Number 1 Region: 374-417,445-494,523-556
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-29
Family Regulator of G-protein signaling, RGS 0.001
Further Details:      
 
Domain Number 2 Region: 204-336
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000789
Family DEP domain 0.02
Further Details:      
 
Domain Number 3 Region: 36-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000726
Family Archaeal DNA-binding protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3CPA5
Sequence length 620
Comment (tr|A0A0C3CPA5|A0A0C3CPA5_HEBCY) Uncharacterized protein {ECO:0000313|EMBL:KIM45934.1} KW=Complete proteome; Reference proteome OX=686832 OS=Hebeloma cylindrosporum h7. GN=M413DRAFT_64397 OC=Hebeloma.
Sequence
MAALADTDPQSTSSHMMKTTKRGRPFLKDTLDLFATLIVSLQLGPHKQFFRTFPHSFSTD
EAAQNLASLKFSQSNRGPDPREPSRVVTTTTTTTFSMTRDMAKAMCQHFMDARLIENATD
PNSNLFKDRGTYVLTPKGLHVLERFVSKNGINSDHLQPVFSSQPICIKLLHLERRSSDDE
IIVTQSVITALFRRFVGRAPNHSPPADKPLDVFQKYNERSKGITLSDMTERAQPLQGKQA
QIHKHCFAAVTALEWLCDFTSVVGREEAAEMAAQFVRFGLITLVSDKRKNNDSAIIFTVR
GSAPGGNSPVSQQGEFRCTAKAIYKVTDEGRRLAHWDNAQPLGVQDSPSTSTANLHDRAS
VDGSMESGPSDKNSHQSNTDRLRYILEEPGLRSLFREFLRGNFSEENLSFWVDVQDFKKK
FNITSSAMAVSPVTRPGNRNTPGQAAMERHHESLINTAFVIYNTYLAPSSQCELNIDHGL
RNELVKYLEEVVTSLTGKAFQGRVEPEQANAFNATQLQTMIRLYERIQMHIFRLMATDSV
PKFIKTPKFLAMRNWVEDFDPTENDIHLLSAGPASPPGLNGSSDEVGGAYMTVSQQASER
EHRQAVAEAATNTTSLSSAS
Download sequence
Identical sequences A0A0C3CPA5
jgi|Hebcy2|64397|e_gw1.4.1115.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]