SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3CYK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3CYK3
Domain Number 1 Region: 79-224
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.05e-24
Family Cofilin-like 0.0024
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.00000000922
Family Cofilin-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3CYK3
Sequence length 251
Comment (tr|A0A0C3CYK3|A0A0C3CYK3_HEBCY) Uncharacterized protein {ECO:0000313|EMBL:KIM49244.1} KW=Complete proteome; Reference proteome OX=686832 OS=Hebeloma cylindrosporum h7. GN=M413DRAFT_438415 OC=Hebeloma.
Sequence
MLYASTRLTLLKSLGSTVFTDSIFATSKEDLTADAYQSHLRHVAAPHPLSIREQEMIELR
AAERETASYDGSRGRTSYIGTGVGLNWSEEAEQAVKELGQGSGSSIVIITVDPQSETLIL
HSTEDIPIASLGSSLLASEPCYALFSWLHSLGPEAKREIIFIYSCPPNSPIKNRMIYSSG
STSTFQTAKTILTSLSPPAPMISRKVETSDPAELDEEYLKAELGCMDKSGGVPLSATHRG
FARPKGPPRRR
Download sequence
Identical sequences A0A0C3CYK3
jgi|Hebcy2|438415|fgenesh1_kg.1_#_678_#_Locus3800v1rpkm16.93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]