SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3E4L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3E4L1
Domain Number 1 Region: 405-519,548-581
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-29
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 
Domain Number 2 Region: 203-335
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-16
Family DEP domain 0.015
Further Details:      
 
Domain Number 3 Region: 36-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000102
Family Archaeal DNA-binding protein 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3E4L1
Sequence length 638
Comment (tr|A0A0C3E4L1|A0A0C3E4L1_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM67730.1} KW=Complete proteome; Reference proteome OX=1036808 OS=Scleroderma citrinum Foug A. GN=SCLCIDRAFT_20759 OC=Sclerodermataceae; Scleroderma.
Sequence
MPADQSEPTPNSSHMMKTTKRGRPYLKDTLDLFATLIVSLQLTTHKQYFRTFPNSFTTDE
AAHNLASLKFSQSNRGPDPRDKSRIVTTTTTTTFSMTRDMAKAMCQHFMDARLIENAADQ
GSNLFKDRGTYVLTPKGLHVLERFISKNGINADHLQHVFTSQPICIKLLHLERRTADDEI
IVTQSVITVLFRRFVGRQSNYPSSSSSPSDAFGEYHERAKGIQLMDVQERSQPSVARSAV
VHQHCFTAVSALEWLCDFTSVVGREEAAEMAAQFVRFGLITLVSDKRKTNDSAIIFTVRG
SAPGGNSPINQHGEFRCTAKAIYKITEEGKRVAQWDETSGSPRSSTTNTHNDRPSIESNA
TVEAGAKSGPEALVSAADAKIHRRISMAEKLNASYDAGEKKGNVKSNMDRLNYILEEPSY
RALFRDFLKSNFCEENLSFWLDVEDFKRKFNITSSAQAAAPTRRGTPGQAAMERHHESLI
QTAFQIYNKYLAPSSQHELNIDHGLRLDLSTYLAEVMTHLNGTSLDGPVNANQVSAFNAT
QLQMLIKLYSRIQTHVLRLMATDSLPKFVKTPRFLEARQWLGEGAAANEDVLFLTSPHAP
PGLGGEESGGAYMTVSSKASEQREQRVPIPGPSQPNNS
Download sequence
Identical sequences A0A0C3E4L1
jgi|Sclci1|20759|gm1.2214_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]