SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3EJ35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3EJ35
Domain Number 1 Region: 99-188
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.16e-21
Family Canonical RBD 0.0021
Further Details:      
 
Weak hits

Sequence:  A0A0C3EJ35
Domain Number - Region: 4-38
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.034
Family beta-sandwich domain of Sec23/24 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3EJ35
Sequence length 212
Comment (tr|A0A0C3EJ35|A0A0C3EJ35_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM67946.1} KW=Complete proteome; Reference proteome OX=1036808 OS=Scleroderma citrinum Foug A. GN=SCLCIDRAFT_1210102 OC=Sclerodermataceae; Scleroderma.
Sequence
MDPSQYQQFNQQQGYDVNPYHQPYQGPIYSIPGSSSSHSAPVPANAYEYDVGIVAQQSVY
VPGAMIDKRGGAGGKLAKGGKRTTVLRKGGGKVWEDQTLLEWNPSWFRLFVGDLSNDVSD
DVLANAFNKYASFQKARVIRDRLSGKARYGFVAFSDPEDFLRAWKEMDGKYVGNRPVKLK
KADDTAIRPVEIGHRKAKQLEKELKKNRRKPY
Download sequence
Identical sequences A0A0C3EJ35
jgi|Sclci1|1210102|fgenesh1_kg.8_#_352_#_Locus2407v1rpkm62.85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]