SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3EV10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3EV10
Domain Number 1 Region: 11-37,144-214
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000053
Family Regulator of G-protein signaling, RGS 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3EV10
Sequence length 437
Comment (tr|A0A0C3EV10|A0A0C3EV10_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM76370.1} KW=Complete proteome; Reference proteome OX=765440 OS=Piloderma croceum F 1598. GN=PILCRDRAFT_647499 OC=Agaricomycetes; Agaricomycetidae; Atheliales; Atheliaceae; Piloderma.
Sequence
MDTDHQCSLTDFEGYLLFREYSVENLQFVVWYQDYRRRFLDAVSNCHSRHSKVHVPNRVS
IDRRATENHQDSPPAPGDDRGGTSEKEWPIQHEIPELGQVSSPDPATKTAPSSVRPIVSR
HQSSTVNNGSRSSEDFVSFSQHRSLDAPPFKDECMRVVATFLRPDSPKELNLDAMIKDAI
IRDLAHSTHPDVFLHAYREAYDMLETTSLPRFISHATANVNLQKQLYHYTVGFICYSVGI
IIAITLIRTVNTNHKPHNRAWRLFAVPWFFSGTTTTYSSFRGICSQVGGRGNLQLRAWEL
EHEDEEAQISMRSIPGQHSRSTHSRRSSDERSLEESKIGNISEVAVPTPGEMAMIAPFAT
SASMTEQRARMVAPFADDVRADKPLIRPKIFGPERVVEDPRIKALHKRLIWEMYFLGICV
AVMFSAIIFSVPCGHPR
Download sequence
Identical sequences A0A0C3EV10
jgi|Pilcr1|647499|CE547999_2490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]