SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3FSG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3FSG1
Domain Number 1 Region: 31-67
Classification Level Classification E-value
Superfamily SAP domain 0.000000696
Family SAP domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3FSG1
Sequence length 152
Comment (tr|A0A0C3FSG1|A0A0C3FSG1_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM87140.1} KW=Complete proteome; Reference proteome OX=765440 OS=Piloderma croceum F 1598. GN=PILCRDRAFT_299859 OC=Agaricomycetes; Agaricomycetidae; Atheliales; Atheliaceae; Piloderma.
Sequence
MLRTALRAHHLRTPIHPLPRYLVSSVLLTRTYENESVAELRKLAKDRGLSPKGNKSTLIT
RIQEHEQHKTIQAVSSAQDPLVPASVQVRHASSASLATSGSEASSPVPGLPHAAQRLDGL
GSTAFTNVNLPDLSQPDPELPTPIVSVKFPPI
Download sequence
Identical sequences A0A0C3FSG1
jgi|Pilcr1|299859|CE200359_4286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]