SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3GLE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3GLE2
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 0.000902
Family Bacterial S-adenosylmethionine decarboxylase 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3GLE2
Sequence length 74
Comment (tr|A0A0C3GLE2|A0A0C3GLE2_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM91406.1} KW=Complete proteome; Reference proteome OX=765440 OS=Piloderma croceum F 1598. GN=PILCRDRAFT_602 OC=Agaricomycetes; Agaricomycetidae; Atheliales; Atheliaceae; Piloderma.
Sequence
MLSSPSASDLYTLFLGCDANFQLLKRVLSDAADVDTLPSVGYFVLERSPDNVANPVVIPK
SHLPAHASPCTSTS
Download sequence
Identical sequences A0A0C3GLE2
jgi|Pilcr1|602|gm1.602_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]