SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3GQY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3GQY1
Domain Number 1 Region: 10-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.75e-16
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3GQY1
Sequence length 147
Comment (tr|A0A0C3GQY1|A0A0C3GQY1_BACIU) Uncharacterized protein {ECO:0000313|EMBL:KIU09944.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=SC09_Contig28orf00071 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSYNFIKANKENDFYPVNQSEIEEVEKNLNLKLPSELVNFYLEVGYGFIKGSEFNTNRIL
DPYSVRDFRLRINDFEFYPDIEIYDEFENDKLIFFEGSESALMSIELNDNNENPIYYYDI
QIATSLTEFLRKIEENDQYYLDLLDDE
Download sequence
Identical sequences A0A0C3GQY1 A0A1Y0WTU6
WP_041334057.1.11088 WP_041334057.1.1358 WP_041334057.1.23108 WP_041334057.1.27612 WP_041334057.1.31786 WP_041334057.1.32025 WP_041334057.1.32693 WP_041334057.1.47672 WP_041334057.1.64889 WP_041334057.1.71402 WP_041334057.1.79288 WP_041334057.1.89821 WP_041334057.1.90830 WP_041334057.1.92915 WP_041334057.1.95211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]