SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3KVN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3KVN0
Domain Number 1 Region: 215-350
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000034
Family Pseudo ankyrin repeat 0.026
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000379
Family Chaperone J-domain 0.0013
Further Details:      
 
Weak hits

Sequence:  A0A0C3KVN0
Domain Number - Region: 114-203
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0981
Family C-terminal domain of PLC-beta 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3KVN0
Sequence length 502
Comment (tr|A0A0C3KVN0|A0A0C3KVN0_PISTI) Uncharacterized protein {ECO:0000313|EMBL:KIO13662.1} KW=Complete proteome; Reference proteome OX=870435 OS=Pisolithus tinctorius Marx 270. GN=M404DRAFT_953247 OC=Pisolithaceae; Pisolithus.
Sequence
MTQVRSAYKQLALRLHPDKNQGNEAATAQFQRLGEAYSIIQRHIETGGHSYTDDDYGDHD
DYFYFDSDSEEYGFYHADDDWEAERTAFFMYLFEEILKGRSGPGYNRYRSYRDQRQPRAP
ETPQQREARFQRQREEQAQAERRRAEEERRRVQQKADRKAFEARMREKERKEAEQRKREK
SASKKAEAEVRRRKAAESLEAQQRRSQTLRSAAFTAARAGDTQQVKKAIWEDSVDPAGGE
VKLGCESFVKEQPQDPTETLLHIATQNGDVDLVKWLDAHSADPEERNSLGLSAFHVALQH
GQLSIVKHFFDAYNPHDEDYNAIYSLASPNNLLSMALESVEPEVVWMILDKGLASTMEIS
DAWTRITSTESREVLLAKAGNATGKYAELQNILMSFGGFTPPPTPQVACQGCERGVSPSS
NASSHTNDKPAPRGNRRGAHDRSSKRAVDPQRQSSYHRPSFPPSHGNVVPSEWSQHDSGR
GKQRGRGRGRGRGHGRSRGRGN
Download sequence
Identical sequences A0A0C3KVN0
jgi|Pisti1|953247|MIX25098_2314_43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]