SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3M6B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3M6B4
Domain Number 1 Region: 48-170
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000471
Family Regulator of G-protein signaling, RGS 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3M6B4
Sequence length 390
Comment (tr|A0A0C3M6B4|A0A0C3M6B4_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIO29187.1} KW=Complete proteome; Reference proteome OX=1051891 OS=Tulasnella calospora MUT 4182. GN=M407DRAFT_228557 OC=Agaricomycetes; Cantharellales; Tulasnellaceae; Tulasnella.
Sequence
MPAYVSRPQRLPYSPKALLHLPYRLFNPPPAPCKTKTWQMSPDYKVELDDVLDNRHLSPM
ALKDFEEFLLFTEFSAENLYFLMWLKEYKRKYQDLGVSKTAAGDLAVQFSRALATFFDPT
SNLALNLPADITSSIIAISKESSHPPPVVFDQVVLQVKGMLRDSLMRFVRLCYGNAGTNR
SWFSAWLGISLVVLGLIPTIASIVTGTSRWIRLSGFLLFWCGSAATIAATHGLCLILYSF
GDGRQLHPYELAAPRLPTTILLGDPPEDEERKIAFTSSVSDHDSMSGLLTASFIAPPAYT
EVASPMGGAFKFDFDALPPTPKSAASQTDPNSSRDSLVSSSPTFGSITRVLNPLIRRSHW
EVAIKSLTLGLLFAIIFSAVCVVLPFRRTH
Download sequence
Identical sequences A0A0C3M6B4
jgi|Tulca1|228557|MIX18963_164_55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]