SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3MJK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3MJK0
Domain Number 1 Region: 62-168
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000824
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3MJK0
Sequence length 575
Comment (tr|A0A0C3MJK0|A0A0C3MJK0_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIO33862.1} KW=Complete proteome; Reference proteome OX=1051891 OS=Tulasnella calospora MUT 4182. GN=M407DRAFT_17463 OC=Agaricomycetes; Cantharellales; Tulasnellaceae; Tulasnella.
Sequence
MARSRPQSFTYSFTRVPWFVVRLMQPPESQGAVKVRGCSVIPPLKIQLRDVIDGKHLPPL
SSTDFEDYLRFQEHSVENLYFMRWLDDYTAKYNAHAASPQAQSYNPQLALSFARARSTFL
SSNSPLAINVESKNAIFPPDCKYPSPEALGGAKHEVEAMLRESLNIFITTRAQGNAGFFH
LISVCTFGALCTLTGLVPILLQIYRGESAGVRSIRLASIAPFWIGMVAFLGALHGVCPIV
WMFGEGRQLQGYELARPQISGPVSHTTMMPKQLSATAAPPNVRAREATGDTVVGGGAGAE
EEVDLKDHLSKMELGFPTPTSAVSELDDVKASPLTPNDGAGKPFVVSTLANAVTLDTRGT
SPVFPNIPTPTSARPLMIDPTYGASGSQTHIPLSPLAGAPSSTAGDITSAPMTAVSSSIS
PFAKYDAGNSNTKSMYQESTSNYTSTALSHDEPYVLDLDSFEPGPQVASAALPRRRLPPR
RPHCSRTLGSALREVAPPAPKWWNKIIGERDEDEFVGGSSKAKLPRPGPFAPMTPIESSI
IRRSNYEVIAKSLVIASILTGALAGGLYAVPVKAH
Download sequence
Identical sequences A0A0C3MJK0
jgi|Tulca1|17463|gm1.1018_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]