SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3MTK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3MTK9
Domain Number 1 Region: 91-217
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.02e-46
Family PH0987 C-terminal domain-like 0.00000745
Further Details:      
 
Domain Number 2 Region: 8-95
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.0000017
Family PH0987 N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3MTK9
Sequence length 220
Comment (tr|A0A0C3MTK9|A0A0C3MTK9_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KIO37022.1} KW=Complete proteome OX=1521167 OS=Shewanella sp. cp20. GN=DB48_07315 OC=Shewanellaceae; Shewanella.
Sequence
MPVLQTSIYPLGERALVLDPAPQAALSWALQSKLCWIAEQLRHLPSVEEAIPGMNNLTIV
VRESRHLKALQAKLDDLWHSAPTEELDSRTIEIPVSYGGEAGPDLHAVAKYHSLSPEEVV
KLHSQVCYRVFFIGFQPGFAYLDGLPETLHTPRLATPRLEVPAGSVGIGGEQTGIYPLAS
PGGWQIIGQTKEMLFDPKSEHPNLLKPGDRVRFTPVEICL
Download sequence
Identical sequences A0A0C3MTK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]