SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3Q3C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3Q3C5
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.86e-37
Family Nip7p homolog, N-terminal domain 0.0000346
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 1.21e-24
Family PUA domain 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3Q3C5
Sequence length 180
Comment (tr|A0A0C3Q3C5|A0A0C3Q3C5_9HOMO) 60S ribosome subunit biogenesis protein NIP7 {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome; Reference proteome OX=1051891 OS=Tulasnella calospora MUT 4182. GN=M407DRAFT_112820 OC=Agaricomycetes; Cantharellales; Tulasnellaceae; Tulasnella.
Sequence
MRPLTEDESKAVFTKLANYIGKNLVHLIDRPDDPHCFRLQKDRVYYMSEANMRMSISVAR
PNLVSVGTCLGKFSKSGVFKLHITALDILAQYAKYKVWVKANGEMPYLYGNHVVKAHLGR
ITEDTPEHQGVVIYSMSDVPLGFGVTARSTVDTRKLDPTAIIVFHQADVGEYLRDEDTLF
Download sequence
Identical sequences A0A0C3Q3C5
jgi|Tulca1|112820|CE25575_7455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]