SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3QPK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3QPK2
Domain Number 1 Region: 417-465,492-541,570-604
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.39e-30
Family Regulator of G-protein signaling, RGS 0.0015
Further Details:      
 
Domain Number 2 Region: 234-328
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000544
Family DEP domain 0.022
Further Details:      
 
Weak hits

Sequence:  A0A0C3QPK2
Domain Number - Region: 32-139
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000363
Family MukF N-terminal domain-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3QPK2
Sequence length 671
Comment (tr|A0A0C3QPK2|A0A0C3QPK2_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIO30236.1} KW=Complete proteome; Reference proteome OX=1051891 OS=Tulasnella calospora MUT 4182. GN=M407DRAFT_20702 OC=Agaricomycetes; Cantharellales; Tulasnellaceae; Tulasnella.
Sequence
MATKSATSSHMMKTTKRGRPFLKDTLDLFATLIVSLDLATHKQFFRTFTNSFTTEEAAIN
LSSLKFSQSTRGPDPRDPSRIVTTTTTTTFSMTRDMAKAMCQHFMDARLIENAADRNSNL
FKERGIYMLTPKGLHVLERFISKNGMTADHLLKVFSSQPICLKLLHLERRGTDDEIIVSQ
SVITALFRRFAGRGANYMPEQVLKDPASEYHERSKGIPLVDITDRAPQMVGKGQLQNFTH
CFAAVAALEWLCDFTSIVGRDEAAEMAAHFVRFGLITLVSDKRKGGDSAVIFTVRGAAAG
NVSAQGEFRCTAKAIYRITEEGRKLARWDAPRPSGGNAVRSSPNNSTVNLESVTRPSTDH
SAEGGANMSEVAYGPGMGVNSKESLAQTTDAKIHRRISMAEKLREGFKAGETAGAPPPTA
NAKESNTDRLRHILDEPALRSLFREFLRGNFCEENLSFWLDVQDFKRRFSTTSSAAAAGG
SRSAAKVTPGQVAMEKHHEALISMAFVIYNTYLAPSSPCELNIDHGLRNELVVYLNEILV
TDGGKQFHGRVEVEHAAQFNATQLQTLIRLYERIQTHVFRLMATDSVPKFIKTSRFLALR
NWVEEFEVGEGDAAAAAAAKKVDPAAPAAPPGLNDEEEEGRAYMSVSQAAHERKPEPAPT
AGPLVPTKSIQ
Download sequence
Identical sequences A0A0C3QPK2
jgi|Tulca1|20702|gm1.4257_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]