SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3QTY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3QTY6
Domain Number 1 Region: 920-1030
Classification Level Classification E-value
Superfamily PX domain 1.11e-22
Family PX domain 0.0012
Further Details:      
 
Domain Number 2 Region: 438-494,541-607
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-16
Family Regulator of G-protein signaling, RGS 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3QTY6
Sequence length 1302
Comment (tr|A0A0C3QTY6|A0A0C3QTY6_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIO31779.1} KW=Complete proteome; Reference proteome OX=1051891 OS=Tulasnella calospora MUT 4182. GN=M407DRAFT_19292 OC=Agaricomycetes; Cantharellales; Tulasnellaceae; Tulasnella.
Sequence
MNQVSWQVLVLGGLVAASIPVVARILLSPIALLILSPAFLLGAVFFAFTSNIGVAWILAF
LGRTKDTDETLRHAARPLVFSTPAAWQAVLIRSKWSSSSKPRNSHPPLLPDSPDISNLLE
EIIEYVIRDFVLVWYSKISPSASFPSALDDTIHSALTILLSRVELLDLPSLIVHRILPKI
TSHVERFRQSEMALRGIGVERHLSQSDELDLLLASRYAGKGGKLHPAVENLSSTVTKQTE
QAHLRMLVEKVLPLVIPEKEIQSRSVMVVAREIIACVVLSSVTEMLADPDFWNKTIDQAA
GAAIRQQKLISKVRNILEAQSATSSGVSVTAQSAAAPKRMENITSRTAARQFESFIQSIN
RCDSLLDARRLKNDVVGEIRRTRVLLANHENEELINGEKASDVVAFLDRLYNAKRHVENR
IAILGGADDDDGRQSIIHEDHDAQGLSLRDVLSSPTSLSYFMEFMDRRDKSLPVQFWLTV
ETFKNPLEDVESDQSDSEPSDEDPISGLPGLPSASATIRGDMTMVDELYFSNAASLAKLS
AISQKHINAVKAYVHDPSTSASAAREKKVRNSVLLAQLQVQRAMEEDFQDFKKSELWFKV
VSDLEANGKSINTAPPLVLQSPEETSPSPSILRPPNLQRSRTGNPRPTFIVPPKPLARMD
TAPAPTSPSASSIPNLALSDAPQTPLSGSTIGMPTPKPSGSNLAFLISPGNEAPRAPLFD
DDDDDGEGVDPVVQQETIDALQAALTDIIATENESIRSGGVRSEVRRSMSFGSDDRPYSP
TMDSSTADLRHLRQQSYKARPSSQVFEDEDEDREHIGPLAGHGPIGGSVQIAAPGDLQLS
YEIDRLAEKISKLQAQETILDALTRKAELTGDGQELKILRRSKAAMDREMRELTFQRSQY
EQQEAENRLVPELTRISISSSTLAMDDATAPGKQVVRYFVEVQQLATDGTFASGWIVARR
YNEFWTLHQKLRDKFVMVRSLEFPPKRLVTSLSNSFVDTRRSQLEKYMQALIKVPLVCES
EELRSFLSRTGTHTGTPTAEQRSSSSISGLIPGQGLVRNMYRSVAESIDDMFFGPSMLDV
MIQRLNKQAAEFAGISGSGVHDEDLIEQALKAKSRSQGGELGRAIPPEETLLRLSSGDLK
PLEGESGLSSFTAPICDLILAVFELDKKNNWLRKQAVVIILQQVLGGTIERKSKEVAKAY
LDESHLLQYVNTFKNIMWPGGSLKGPSEPRTAEEKIRTRDEANRKLSTLMPDLAANMIGR
SNARRGARRIFAVLQNKRLNQHIVYSVIDEVFAALFPEANIL
Download sequence
Identical sequences A0A0C3QTY6
jgi|Tulca1|19292|gm1.2847_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]