SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3S341 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3S341
Domain Number 1 Region: 394-439,468-517,546-575
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-27
Family Regulator of G-protein signaling, RGS 0.0016
Further Details:      
 
Domain Number 2 Region: 203-333
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000115
Family DEP domain 0.025
Further Details:      
 
Domain Number 3 Region: 34-146
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000817
Family MukF N-terminal domain-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3S341
Sequence length 632
Comment (tr|A0A0C3S341|A0A0C3S341_PHLGI) Uncharacterized protein {ECO:0000313|EMBL:KIP09846.1} KW=Complete proteome; Reference proteome OX=745531 OS=Phlebiopsis gigantea 11061_1 CR5-6. GN=PHLGIDRAFT_18494 OC=Agaricomycetes; Polyporales; Phanerochaetaceae; Phlebiopsis.
Sequence
MATPQEAAAASTSHMMKTTKRGRPFLKDTLDLFATLIVSLQLQTNRQFFRNFPNSFLTDD
AARNLASLKFSQSNRGPDPREPSRIVTTTTTTTFSMTREMAKAMCQHFMDARLIENAADP
GSNLFKDRGVYVLTPKGLHVLERFMSKNGINGDHLAHVFTSQPICMKLLHLERRSVDDEI
IVSHGVITALFRRFVGRQPNYPPDNIDSLDTFLKYQERSKGVALMDVTERAAPGGKSITH
RTCFPAVSALEWLCDFTSVIGREEAAEMAAQFVRYGLIILVSDKRRNNDSAIIFTVRGAA
GGPNSPIQQHGEFRCTAKAIYKITDEGRRLARWDQPEGARDSPNSSSVALSTNARSSEDV
VESAEAKSVGDAQKLHRRMSLTEKLNGSHDSDKKGRKENNSERLKHIIEEPQLRNLFREF
LRANFCEENLSFYLDVQDFKRKFNITSSAVAATSTAARPGQKSTPGQAAMERHHESLIQM
AFVIYNTYLAQSSQCELNIDHGLRNELSGYLSDVITNLTGKAFQGRVEMEQANAFNATQL
QTMIRLYERIQMHVFRLMATDSVPKFIKTPRFLALKIQLNDDDDDLDDFPVVSANNSTPS
VPPGLNEEEVGGAYVTVSQRAAAMDRPQAAHN
Download sequence
Identical sequences A0A0C3S341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]