SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3S3A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3S3A2
Domain Number 1 Region: 128-185,213-265
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000105
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3S3A2
Sequence length 316
Comment (tr|A0A0C3S3A2|A0A0C3S3A2_PHLGI) Uncharacterized protein {ECO:0000313|EMBL:KIP02285.1} KW=Complete proteome; Reference proteome OX=745531 OS=Phlebiopsis gigantea 11061_1 CR5-6. GN=PHLGIDRAFT_96146 OC=Agaricomycetes; Polyporales; Phanerochaetaceae; Phlebiopsis.
Sequence
MDHLGDWELAKAVGVPTSLPLPLDWTDANQTDHAVLSGYLPLIRATDPNGYPPTKTSATL
MVRFGYVHVLEYFLVQHRTIFRDLYKHDLLPITASQHGRVSVLAWWKRARELYPDFIRAP
SPESISEAIDGASRNGHVKSLDWWLESGFPLEYTEAALEMASLKNHIDVLDWWKRKSKAN
RLVMKVGRVMDMASTAGHVEVLDWWARHQPEVKYDRQAMYHASCHGKVEVLQWWLESGLQ
LIFDPDALVGATKHNRPEVLEWWDKSGLPIQYRMCDVEEALEDAIGGGEAARQWWKRKGV
DFNANDKEWMKLQNLN
Download sequence
Identical sequences A0A0C3S3A2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]