SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3SEX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3SEX9
Domain Number 1 Region: 868-979
Classification Level Classification E-value
Superfamily PX domain 1.05e-22
Family PX domain 0.00081
Further Details:      
 
Domain Number 2 Region: 428-485,526-590
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000236
Family Regulator of G-protein signaling, RGS 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3SEX9
Sequence length 1239
Comment (tr|A0A0C3SEX9|A0A0C3SEX9_PHLGI) Uncharacterized protein {ECO:0000313|EMBL:KIP11115.1} KW=Complete proteome; Reference proteome OX=745531 OS=Phlebiopsis gigantea 11061_1 CR5-6. GN=PHLGIDRAFT_125019 OC=Agaricomycetes; Polyporales; Phanerochaetaceae; Phlebiopsis.
Sequence
MQNLNRQGWLLAGVLAIVTPVLVQIFSSPITVLLLSPLILLVIVVAFFVANLLLAYLLDV
HQPPVTGPPPVAGRPLAFSTPAAWQAVLTRSQWAHKSSNSLAPLYPESAAISAALNDLLT
LIVRDFVLSWYRELSNSPSFPTAVSATMHGALQRLLARAETLDIPALVVKRIMPQVTAHI
ENFRQSEVALRGAGLERRLTQSEELDLLLASRYAGRSGGKLHPAIDNLSSTFTKQTEENH
LRALVDRALPYILPEKEARSECVRIVVREIASCSVLYPVMDMLSDPDFWNRSINQVAGEA
IRQQKLIVKVRNVLEAQLPRPHLRTSEPSAPTTDRITIRTDARHFESFLRSISRCSSLLD
ARRLKNDIMGEIRRTRALLSNHENEEWINGEKTEDIVAFLDRLYTAKRKVEKRIAVLGGE
SDIRPTASSPETRIGSRISLRDILTNPTSLSYFMEFMDRRKRSLLVQFWLTVESFKNPLE
SVDSGSDNDDNEPIRDPSLTDTLKEDILMMNELYFSGPVTDPALSVISQKYVHIIRSFGV
EDDPSTASAEKRVRRSVMLAQRQVERDIEQQDFEDFQRSELWFHVVADSELSGSRGSGDA
TPVRASTTIEVGPSQRVPKTRSETAPAKFGAALGSFHLQESSTSSVVSQAGTPVQGAGPR
SSPSDLEVLMSPAATGGPSSSRAPLFDDPEDAKFDAALEAHSQRMEAIQAALTDIIALDQ
HESSQNSIAREGSLSDSAILSAPSIGGRSISGETRVDPPSDDEGDIEDQRGDGDEQRHSS
FQLAGPGDLHLSYEIARLSDKVTSLQTQEGMLDTLIKKAELTGDEQELQLLQKSKSSLAR
DLRELNFQKTQYEQQESANRLVSDRTKIAIVNSTVGEENGKSVVRYLIEVQQLASDASFA
SGWVVARRYNEFFNMHTKLRERYALVRSLDFPGKRLVTSLSNSFVDSRRTALEKYMQSLI
AIPAVCESAELRVFLSRDSPFMAALPPPEDKAPSNQAGPAPQGKSFMRSMYKSVADSIDD
MFFGPSMLDVIIQRLTTQAAEFVGIVGSGVHDEDLVAQALRASSQASSEDSLMQLPGDLK
PLEGETSMSSFSSPICDLVLAVFELNKKNNWLRRQAIVIILQQVFGQTIERKLRETAKAF
FDESHVLSYIDIFHASMWNGGQLKPSGQPRSAEEKLRARDDANRKLSALIPDLGANMIGR
SNARRGARRLFAVLQNRRLNQHLLYTIVDEVFGALFPEQ
Download sequence
Identical sequences A0A0C3SEX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]