SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C4DU52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C4DU52
Domain Number 1 Region: 552-666
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.41e-18
Family Regulator of G-protein signaling, RGS 0.0024
Further Details:      
 
Domain Number 2 Region: 688-786
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.6e-17
Family Flavin-binding PAS domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C4DU52
Sequence length 1055
Comment (tr|A0A0C4DU52|A0A0C4DU52_MAGP6) Uncharacterized protein {ECO:0000313|EMBL:KLU84445.1, ECO:0000313|EnsemblFungi:MAPG_03487T0} KW=Complete proteome; Reference proteome OX=644358 OS=fungus) (Magnaporthe poae). GN=MAPG_03487 OC=Magnaporthiopsis.
Sequence
MSVMDKEAFGSAAVPEERNPDEGLLRRILPQRSRDAIAALRLHMAGEDDELALGSVDASS
ATATAALRQAPARAARGIEDLSQAMHMHDDRHRRHHQDQHARQRQSQYGVPLHAGTAHKD
ASKDGSYLGHLSAKRRSGMVSRFEGTVSNSPVQVRHRQEIVANEQGLPPFLPIGPAGFSG
ESSRRLSRQVVQRSDGSIVVPRRDSSSRPSRRAERSASPGPSKLRPRDDTGRGLWEHPPT
RAEIEAAKKILQQFVMNGGGDGSPAAPRTPKTPRRGVVQEEEEEEDGQGTLTRTAATPPA
RRPRRVIQDESDFEDEGDGKHIPLIGGNYQVVHMDEDHHAVHCGGRTGATAGHEHDHPMA
NDDVFESRNTAEAGQPRGAPGAGESSPERRSPVLDHLRLYSDAAPSPIIPDDRTYSAYDF
RSFDGGSVGDDGISVADSQHSYNHEDDYGHAHHASNGHRRGYSDDYGVPSILQRPSTMAS
GSHESVDHHRQRQPSSPPPDRELHKKFSREPPPRVTSIRPGVSASRRIGGTSIGGTSMTG
GSRMPDFFGPSIFQVVLRNPTTVHQLRKYCESRFCDENIEFLQHIDLYHNRLNEIITTLT
DIHKSYVSDSSPKQVNLQSSVIAQLHTDMRAMVSNTLPAMESLFTAAQESVQNLIYTDVY
PGFVRHQLALSASRALAEDKTRYKGLGDCFCLTDPVKPQNPILWASDGFVSVTGYTRADI
IPRNCRFLQGSQTDPEAVKRLSMAIKERRETVELLLNYKKNKQPFWNLLYCAPLYDEAGN
LAFFIGGQVNCSTTIHSSVDVMRVLSMSAEGDYVKEMEDKQRQEKEKARTQAKLAADRGG
QPSNGSACKNKGGSTRRSLLKVLGVRLGSSNGHTAATVEEEHKPTPVIENVEAGMEQKVL
ERMEGQELDAQKKEFYTAYSKYIVVDSGFIIRFYSAGITEMLHPANNAAGTIVGTDVFTF
LKRNGLPQRPAQQQQQLQQQQGGHTVSGDASPEYKDRVQAAVVGQGSPISIEVRMQTRRS
AVFRGDERFAAHWTPLKDDAGRVGWVVLTLGNMMM
Download sequence
Identical sequences A0A0C4DU52
MAPG_03487T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]