SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C4DYV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C4DYV4
Domain Number - Region: 176-233
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0157
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C4DYV4
Sequence length 275
Comment (tr|A0A0C4DYV4|A0A0C4DYV4_MAGP6) Arv1 superfamily protein {ECO:0000313|EMBL:KLU86216.1} KW=Complete proteome; Reference proteome OX=644358 OS=fungus) (Magnaporthe poae). GN=MAPG_05233 OC=Magnaporthiopsis.
Sequence
MPICIECRHPVRTLWTKYSGAGDKSSGHNIRLTVCKNCGRFCDKYVEHDFVVLFIDLVLI
KPQVYRHLLHNSLMREGDRFDPAMIRLGVLLLLFDVYLTWARIEKQFSADSVPYQTSFGR
LSQQPIVFQYLFFLLLCSLSNLAFHLSIRLLTSSPFSPLALLGLLPTYPRPNSVSTALLV
SSSTKLFPILMVIWEYDVPAAARSLGWAVVLNNVEALKILLDCGYGAHALPSSATLASPA
ESTPSSPAAHRNTDPTAQRLRAPAMASRAVVLSLQ
Download sequence
Identical sequences A0A0C4DYV4
MAPG_05233T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]