SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C4EPI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C4EPI8
Domain Number 1 Region: 466-508,542-588,634-668
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.77e-20
Family Regulator of G-protein signaling, RGS 0.0021
Further Details:      
 
Domain Number 2 Region: 254-367
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000836
Family DEP domain 0.031
Further Details:      
 
Weak hits

Sequence:  A0A0C4EPI8
Domain Number - Region: 54-167
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000128
Family MukF N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C4EPI8
Sequence length 709
Comment (tr|A0A0C4EPI8|A0A0C4EPI8_PUCT1) Uncharacterized protein {ECO:0000313|EnsemblFungi:PTTG_02690P0} OX=630390 OS=fungus). GN= OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MAADPRTRQQSTSHILKTGKRGNPFVKVCADPQLGSLPRLAPFQTALTPHLQDTHDLFST
LVASLQLSTNTRFFRSYPNSFTTDDAAANLSSLRFSQSNRSTDPNDPSRIVTTTTTTTFS
MNRDIAKGICQHFMDARLIENAADPLNPTFKERGIYQITPKGLHVLERFVTKNGIHADHL
VRVFTTQPICMKLLHLERRPTDDEIHITPNVINVVFKRFSGGRSPNYVSDPAELHRNTAL
RPFSENPRLTPNYDRSLGVELQDVRERAASGTTLLVKHVFSSTVAIDWLVDFSTCCGREE
AAELLAHFVRYGLITLHIDRSKGADKVAHALVRAPASEPTIPGVSLEGQFKYGAKVTYRI
TDEGRRLSGLDGSTERAHYKIGVAATTRTSEDDLQSVSHHHHQTNSSQHHHQQHQQHHHH
HPTADPTSLGPLADQGQQQNEGRQVLRDILHADSSDGSAWVRDATSSSARLKAILGEPAL
RSLFRDFLRSHICEENLHYWIDVQEFRRRFATSSTAVGVGSAPHSSSSSKKKAPSSAASA
MEQHQEKLVATALLIFNSYLAPGSPSELNIDHNLRADVISYMSRAVDEAKGTPNSPETNE
GSVPALRATQVQALLRHYERIADHIYRYVHLSLSLFPICALISSGEARLMATDQVPKFVR
TERFLEILSAQQLDESRDGSATTLTSGYGSDPLLLSASASSIPPPVSAS
Download sequence
Identical sequences A0A0C4EPI8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]