SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C4EY48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C4EY48
Domain Number 1 Region: 80-230
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.54e-56
Family Poly(A) polymerase, PAP, middle domain 0.00000153
Further Details:      
 
Domain Number 2 Region: 232-343
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 1.06e-29
Family Poly(A) polymerase, PAP, C-terminal domain 0.00045
Further Details:      
 
Domain Number 3 Region: 2-77
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.17e-16
Family Poly(A) polymerase, PAP, N-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C4EY48
Sequence length 359
Comment (tr|A0A0C4EY48|A0A0C4EY48_PUCT1) Uncharacterized protein {ECO:0000313|EnsemblFungi:PTTG_05747P0} OX=630390 OS=fungus). GN= OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MLNDRPEVTELATVPEAFVPIIKLKFSSIEVDLLFARLALPSIPDSLELIDDALLKNLDD
RCVRSLGGSRVTDEILRLVPDVTVFRDSLRAIKLWAKSRAVYSNVMGFCGGVAWAMCVAR
VCQLYPNKPAGTIVNRFFAVLSQWNWPSPVLLKPIGPAPPGDQRRIWNPKIYPQDRGHRM
PIITPAYPCMCSTHNITKSTAQIMMTEFKRGLAVTDEIATGTKPWAALFDKHDFFTRYRY
YLQITASSPNAEIQLKWAGTVEARLRQLVMKVEEVDTVDLAHPFIKGFERESYYLTSDEV
RVIQVGDVPPDVKGRTRADIEGKEGAGTVYTSSFFIGLLVQPKPGLFISQWGLTHSGIS
Download sequence
Identical sequences A0A0C4EY48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]