SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C4F5D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C4F5D7
Domain Number 1 Region: 11-314
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.57e-41
Family WD40-repeat 0.00094
Further Details:      
 
Domain Number 2 Region: 280-462
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000565
Family YVTN repeat 0.027
Further Details:      
 
Weak hits

Sequence:  A0A0C4F5D7
Domain Number - Region: 571-681
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0068
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C4F5D7
Sequence length 1184
Comment (tr|A0A0C4F5D7|A0A0C4F5D7_PUCT1) Coatomer subunit alpha {ECO:0000256|PIRNR:PIRNR003354} OX=630390 OS=fungus). GN= OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MQMLTKVGAPGHPPARFESKSNRVKGIAFHPKLTLLAASLHSGSIQMWNFQMGTLVERFD
EHDGTTLPLSNILLTTNTNDWPFFQGPHYIMYAEFHPKDDYIVSCSMDQTVRVWDITGLR
KKTTTAQPMSFEDQVQRANSGQADLFGNTDAVVKYVLEGHDRGVNWATFHPTLPLIVSCG
DDRQVKLWRMSETKAWEVDTCRGHFNNISAVLFHPKHELIISDSEDKTIRVWDMSKRTAV
QTFRRENDRFWVLTAHPELNLFAAGHDTGLIVFKLDRERPAFSLHGNTLFYIRDKYVRVH
DLSTGSDVSVISVKKLGSQYVQPRTLSYNPAERAVLVTSPAENGMYELVNLPKDMNAGEV
RDSSSEGKRGNGQAALFVARNRFAVLDKTSQTIEIRDLSNSITKSIKCPSPTNDIFYGGT
ASLLLSTNTSVILFDIQQQKVVSEITTPPVKYVVWSNDGSMVALLSKHTIIIANKALGQH
SLIHETIRIKSGAWDDCGILVYSTLNHIKYALPQGDNGIIKTLDQPVYLTRVKGKMVHCL
DRNAKPKGIPIDPTEYRFKLALTRNNYDEVLHIIRTSNLVGQSIIAYLQKKGFPEIALHF
VQDKTTRFDLAIECGNLEVALETAKAIDRPASWNRLGQQALKQGNQKIVETCYQRTKNFD
RLSFLYLLTGNTEKLNKMAKIAEMRADHMSRFHNALYLGNVKTRISVLKDVGLYPLAYLT
AKSNGLDDEANEVLEVAGLTEEELPPLPPLKSSRLTPPGIVTASHDFNWPCVGTSESFFD
RALTQASGMDANANPIDSLGGAGRGDPLDEWAADDGDGMDVEGDAGEEAEEAWDIGGSEI
PGGALDAEAGESETMGVEEDGADGEVKEGVQESELWVKNSPLAADHVAAGSFETAMQLLN
RQVGAIEFAPLKPLFLSTYQASRAYLPASACLPPLEVYLRRDPEDVNPRNVLPAIARSLQ
SITQTELKAAYAHFRKAEFNEASAKFRSILQSLLLVVTKDEAEQNELSELIITCREYLIG
LSLEIERRRVASSEPENLKRQLELAAYFTHCKLQSVHLVLALRLAMTTFSKSKNFVTAAT
FAKRLLELNPAANVATQAKQVLSAGDRTPRDAIEIDYDQFSSFDICAGSLTPIYRQQEGS
TGGAGFVEDPFTGARYKPKFAGSVCKVSGVTQVGKKAAGLRSRV
Download sequence
Identical sequences A0A0C4F5D7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]