SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C4KX50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C4KX50
Domain Number 1 Region: 1-29
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.000000000663
Family p53 DNA-binding domain-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C4KX50
Sequence length 43
Comment (tr|A0A0C4KX50|A0A0C4KX50_HUMAN) p53 protein {ECO:0000313|EMBL:AHZ21041.1} OX=9606 OS=Homo sapiens (Human). GN=p53 OC=Catarrhini; Hominidae; Homo.
Sequence
YSPALNKMFCQLAKTCPVQLWVDSTPPPAPASAPWPSTSSHST
Download sequence
Identical sequences A0A0C4KX50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]