SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5ACH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5ACH6
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 4.45e-70
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C5ACH6
Sequence length 139
Comment (tr|A0A0C5ACH6|A0A0C5ACH6_9BACT) McrA protein {ECO:0000313|EMBL:AJK26866.1} OX=77133 OS=uncultured bacterium. GN=mcrA OC=Bacteria; environmental samples.
Sequence
ATAAYTDDILDDFTYYGAEYVEDKFGICEAPITEETVNDVATEVTLYSLEQYEIPTLLED
HFGGSQRAAVVAAASGLSCAFATGNSNAGVNGWYLSQLLHKETHSRLGFYGYDLQDQCGS
SNSLAIRGDEGLIHELRGP
Download sequence
Identical sequences A0A0C5ACH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]