SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5AZC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5AZC1
Domain Number 1 Region: 167-195,262-306,338-349
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000667
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C5AZC1
Sequence length 528
Comment (tr|A0A0C5AZC1|A0A0C5AZC1_ASF) MGF 505-7R {ECO:0000313|EMBL:AJL34045.1} KW=Complete proteome OX=10497 OS=African swine fever virus (ASFV). GN=MGF OC=Viruses; dsDNA viruses, no RNA stage; Asfarviridae; Asfivirus. OH=6938,9823,41426
Sequence
MFSLQDLCRKNTFFLPNDFKKHTLQLLGLYWKEHGSVHRAEKDNIMIQNELILTVNDALQ
LAGEEGDTDVVQLLLLWEGNLHYAIIGALKAENYNLICEYHSQIEDWHALLPLIQDPETF
EKCHELSLGCDLLCLLQHAVKCNMLSILVKYKEDLLNARIRHRIQSLFVLACENRRIEII
LWIGQNLPIPEPETIFSIAVITKDLELFSLGYKIIFDYMQRQGIFQLSEVVRKILLNRHI
DMAVNKGLLPFVLETFKYGGSIKRALSCAVMDNKRKVIDYLVRHENISHQTIERLLYLAV
KKHSSKKTLNLLLSYINYKVKNIKKLLDHVLGGNSTLVLKILLEKKQNLVDAALTRLVKH
STYFRVKEFIEDFSISPEKFIKIAVREQKNVIIKVICEDIWENPAERIRYLKQIVSSIKY
ESGRQFLINIIHTIYQSHSLKPEEIFKLATFYVKHNAVTHFKDLCKFLWLNRGIESKKHF
LRCLEIADEKDFPAIKSIVSEYINYMFTAGTMTKDEIMQAYASEYAMC
Download sequence
Identical sequences A0A0C5AZC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]