SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5B5Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5B5Y7
Domain Number 1 Region: 27-128
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 4.84e-17
Family Insect pheromone/odorant-binding proteins 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C5B5Y7
Sequence length 134
Comment (tr|A0A0C5B5Y7|A0A0C5B5Y7_TENMO) Odorant-binding protein 13 mRNA {ECO:0000313|EMBL:AJM71487.1} OX=7067 OS=Tenebrio molitor (Yellow mealworm beetle). GN= OC=Cucujiformia; Tenebrionidae; Tenebrio.
Sequence
MRHSTLLVLVALVAAVQMQELSNRGVELFKQMYSSCLQKSNVNVTYALETFNGVVENEPK
LKEFLFCSNKQNGFQDRRGNLRPDAVRRRLQNNVFIDSQTIETIVSECTERKESPQETAY
HFWKCSFKKVTGTA
Download sequence
Identical sequences A0A0C5B5Y7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]