SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5C6W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5C6W1
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 7.59e-57
Family Obg GTP-binding protein N-terminal domain 0.0000000866
Further Details:      
 
Domain Number 2 Region: 151-332
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-51
Family G proteins 0.000000203
Further Details:      
 
Domain Number 3 Region: 358-430
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 4.18e-25
Family Obg GTP-binding protein C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C5C6W1
Sequence length 430
Comment (tr|A0A0C5C6W1|A0A0C5C6W1_BACCO) GTP-binding protein Obg {ECO:0000256|HAMAP-Rule:MF_01454} KW=Complete proteome OX=1398 OS=Bacillus coagulans. GN=CAY57_05070 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MFVDQVKIYVKGGDGGNGMVAFRREKYVPMGGPAGGDGGRGGDVIFEVDEGLRTLMDFRY
KRHFKADHGENGMSKGKHGRGAKDMIVKVPPGTVVIDDDTKQTIADLTRHGERAVIAKGG
RGGRGNIRFATPANPAPEIAENGEPGQERYIVLELKLLADVGLVGFPSVGKSTLLSVISS
ARPKIAEYHFTTLVPNLGVVETEDGRSFVMADLPGLIEGAHEGVGLGHQFLRHIERTRLI
VHVIDMAAVEGRDPYEDYLTINKELKAYHERLSERPQLIIANKMDLPGAEENLAAFKEKL
GDVARVFPISAVTRKGLRDVLFAIADLLDETPAFPLHAGEEPDAEPSRVLYKHEKEKADF
TITRDPDGSFVIHGEKVEKLFKMTNFSHDESVRRFARQLRGMGIDDALRARGAKNGDTVR
LLDFEFEFVD
Download sequence
Identical sequences A0A0C5C6W1
WP_017551053.1.2021 WP_017551053.1.29296 WP_017551053.1.31175 WP_017551053.1.33841 WP_017551053.1.40589 WP_017551053.1.65678 WP_017551053.1.71372 WP_017551053.1.76215 WP_017551053.1.83376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]