SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5VN51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5VN51
Domain Number 1 Region: 10-153
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-17
Family SMI1/KNR4-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C5VN51
Sequence length 158
Comment (tr|A0A0C5VN51|A0A0C5VN51_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:AJQ94748.1} KW=Complete proteome; Reference proteome OX=1445510 OS=Gynuella sunshinyii YC6258. GN=YC6258_02710 OC=Saccharospirillaceae; Gynuella.
Sequence
MTTTTFSDIGSQLSKSDLAEIEKRLGFQLPDTLKVFYLQTNGGTPEPDHWIGDDDFEPIY
VSGFLKMKDTSPGESSLEDTYQNGISKGFIPTHLLPFALDWGNNYICIDMTGKVFFLATD
SWHDDLSMEDNVKKNTRLLCNTLDEFIDSLVSEDEAYG
Download sequence
Identical sequences A0A0C5VN51
WP_044617220.1.81077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]