SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5X1B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5X1B3
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.4e-29
Family Ribosomal L27 protein 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C5X1B3
Sequence length 84
Comment (tr|A0A0C5X1B3|A0A0C5X1B3_9MOLU) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome OX=86660 OS=Mycoplasma dispar. GN=MDIS_00945 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MAKTKAGGSTKNGRDSAGRRLGQKIADGQFAFTGSIIYRQRGTRIYPGKNVGIGGDDTLF
ALADGIVKFQKVRKRKYASIVING
Download sequence
Identical sequences A0A0C5X1B3
WP_044635245.1.37945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]