SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C6F568 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C6F568
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.59e-43
Family SMI1/KNR4-like 0.000000968
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C6F568
Sequence length 133
Comment (tr|A0A0C6F568|A0A0C6F568_PSEAI) SMI1/KNR4 family protein {ECO:0000313|EMBL:OZO14226.1} KW=Complete proteome OX=287 OS=Pseudomonas aeruginosa. GN=AO964_06125 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEDVIEKLRELNEPVPVPLELPEEELLVEIEEELLIGIPAEFREFLLLVSDVVYGRLEPV
TVTDPHSHTYLPEVAATAWDLGVPRELIPLCEDDGSYYCVAEDGEVVLWADGDLTDESWD
SVWVWARDVWLES
Download sequence
Identical sequences A0A0C6F568 A0A0E1B7K5 A0A0H2ZJV0 A0A0H3QVX6 A0A157VGH7 A0A1C7BBU4 A0A1E9C9J6 A0A1F0IVZ2 A0A1G5L6T3 A0A1S1BYS2 Q9HT46 W1MWK4
gi|558675716|ref|YP_008812424.1| gi|218894630|ref|YP_002443500.1| gi|15600720|ref|NP_254214.1| 208963.PA14_72920 208964.PA5527 557722.PLES_59231 gi|386061706|ref|YP_005978228.1| NP_254214.1.87394 WP_003099687.1.100071 WP_003099687.1.100100 WP_003099687.1.100179 WP_003099687.1.100276 WP_003099687.1.100278 WP_003099687.1.100319 WP_003099687.1.100394 WP_003099687.1.100420 WP_003099687.1.100473 WP_003099687.1.100476 WP_003099687.1.100523 WP_003099687.1.100654 WP_003099687.1.100723 WP_003099687.1.100742 WP_003099687.1.100777 WP_003099687.1.100786 WP_003099687.1.100808 WP_003099687.1.100809 WP_003099687.1.100810 WP_003099687.1.100872 WP_003099687.1.100983 WP_003099687.1.100995 WP_003099687.1.101021 WP_003099687.1.101047 WP_003099687.1.101090 WP_003099687.1.101269 WP_003099687.1.101310 WP_003099687.1.101340 WP_003099687.1.101506 WP_003099687.1.101572 WP_003099687.1.101642 WP_003099687.1.101712 WP_003099687.1.101739 WP_003099687.1.10179 WP_003099687.1.101809 WP_003099687.1.101819 WP_003099687.1.10185 WP_003099687.1.101863 WP_003099687.1.101871 WP_003099687.1.10201 WP_003099687.1.10202 WP_003099687.1.10204 WP_003099687.1.102045 WP_003099687.1.10228 WP_003099687.1.10248 WP_003099687.1.10257 WP_003099687.1.1037 WP_003099687.1.10407 WP_003099687.1.10419 WP_003099687.1.10435 WP_003099687.1.10457 WP_003099687.1.10468 WP_003099687.1.10477 WP_003099687.1.10482 WP_003099687.1.10513 WP_003099687.1.10529 WP_003099687.1.10548 WP_003099687.1.10572 WP_003099687.1.10575 WP_003099687.1.10636 WP_003099687.1.10641 WP_003099687.1.10684 WP_003099687.1.10764 WP_003099687.1.10856 WP_003099687.1.10895 WP_003099687.1.10901 WP_003099687.1.10949 WP_003099687.1.11026 WP_003099687.1.11058 WP_003099687.1.1107 WP_003099687.1.11077 WP_003099687.1.1109 WP_003099687.1.11163 WP_003099687.1.11178 WP_003099687.1.11180 WP_003099687.1.11318 WP_003099687.1.11381 WP_003099687.1.11388 WP_003099687.1.11410 WP_003099687.1.11568 WP_003099687.1.11569 WP_003099687.1.11653 WP_003099687.1.11744 WP_003099687.1.11754 WP_003099687.1.1180 WP_003099687.1.11847 WP_003099687.1.11854 WP_003099687.1.1187 WP_003099687.1.11943 WP_003099687.1.12018 WP_003099687.1.12081 WP_003099687.1.12120 WP_003099687.1.12150 WP_003099687.1.12200 WP_003099687.1.12208 WP_003099687.1.12240 WP_003099687.1.12302 WP_003099687.1.12354 WP_003099687.1.1238 WP_003099687.1.12400 WP_003099687.1.12482 WP_003099687.1.12497 WP_003099687.1.12530 WP_003099687.1.12547 WP_003099687.1.12561 WP_003099687.1.12657 WP_003099687.1.12670 WP_003099687.1.12687 WP_003099687.1.12744 WP_003099687.1.12797 WP_003099687.1.12838 WP_003099687.1.12873 WP_003099687.1.12891 WP_003099687.1.12922 WP_003099687.1.12930 WP_003099687.1.12934 WP_003099687.1.12970 WP_003099687.1.12980 WP_003099687.1.13 WP_003099687.1.13041 WP_003099687.1.1305 WP_003099687.1.13057 WP_003099687.1.13085 WP_003099687.1.13092 WP_003099687.1.13208 WP_003099687.1.13232 WP_003099687.1.13242 WP_003099687.1.13266 WP_003099687.1.13270 WP_003099687.1.13315 WP_003099687.1.1333 WP_003099687.1.13407 WP_003099687.1.13529 WP_003099687.1.13533 WP_003099687.1.1356 WP_003099687.1.1362 WP_003099687.1.13622 WP_003099687.1.13718 WP_003099687.1.13758 WP_003099687.1.13765 WP_003099687.1.13785 WP_003099687.1.13828 WP_003099687.1.13865 WP_003099687.1.1393 WP_003099687.1.14049 WP_003099687.1.14078 WP_003099687.1.14096 WP_003099687.1.14204 WP_003099687.1.14251 WP_003099687.1.14378 WP_003099687.1.14424 WP_003099687.1.14455 WP_003099687.1.14460 WP_003099687.1.14463 WP_003099687.1.14476 WP_003099687.1.14525 WP_003099687.1.14615 WP_003099687.1.14640 WP_003099687.1.14714 WP_003099687.1.1475 WP_003099687.1.14754 WP_003099687.1.14797 WP_003099687.1.14815 WP_003099687.1.14820 WP_003099687.1.14835 WP_003099687.1.14839 WP_003099687.1.14883 WP_003099687.1.14966 WP_003099687.1.14981 WP_003099687.1.15004 WP_003099687.1.15130 WP_003099687.1.1516 WP_003099687.1.152 WP_003099687.1.15222 WP_003099687.1.15231 WP_003099687.1.15281 WP_003099687.1.15297 WP_003099687.1.15328 WP_003099687.1.15373 WP_003099687.1.15379 WP_003099687.1.15474 WP_003099687.1.15480 WP_003099687.1.15482 WP_003099687.1.15485 WP_003099687.1.15602 WP_003099687.1.15606 WP_003099687.1.15692 WP_003099687.1.15886 WP_003099687.1.15889 WP_003099687.1.15934 WP_003099687.1.16041 WP_003099687.1.16074 WP_003099687.1.16109 WP_003099687.1.16142 WP_003099687.1.16161 WP_003099687.1.16197 WP_003099687.1.162 WP_003099687.1.16239 WP_003099687.1.16242 WP_003099687.1.16267 WP_003099687.1.16279 WP_003099687.1.16419 WP_003099687.1.1646 WP_003099687.1.16660 WP_003099687.1.1670 WP_003099687.1.1671 WP_003099687.1.16751 WP_003099687.1.16782 WP_003099687.1.16788 WP_003099687.1.16801 WP_003099687.1.16808 WP_003099687.1.16895 WP_003099687.1.17022 WP_003099687.1.1704 WP_003099687.1.17108 WP_003099687.1.17155 WP_003099687.1.17162 WP_003099687.1.17177 WP_003099687.1.172 WP_003099687.1.17223 WP_003099687.1.17353 WP_003099687.1.17354 WP_003099687.1.17370 WP_003099687.1.1739 WP_003099687.1.17397 WP_003099687.1.17566 WP_003099687.1.1758 WP_003099687.1.1761 WP_003099687.1.17697 WP_003099687.1.17883 WP_003099687.1.17890 WP_003099687.1.18052 WP_003099687.1.18054 WP_003099687.1.18117 WP_003099687.1.18156 WP_003099687.1.18157 WP_003099687.1.18199 WP_003099687.1.18204 WP_003099687.1.18234 WP_003099687.1.1824 WP_003099687.1.18349 WP_003099687.1.18440 WP_003099687.1.18493 WP_003099687.1.18508 WP_003099687.1.18547 WP_003099687.1.18653 WP_003099687.1.18728 WP_003099687.1.18769 WP_003099687.1.18795 WP_003099687.1.18852 WP_003099687.1.18892 WP_003099687.1.18907 WP_003099687.1.18911 WP_003099687.1.18930 WP_003099687.1.190 WP_003099687.1.19089 WP_003099687.1.19199 WP_003099687.1.19251 WP_003099687.1.19260 WP_003099687.1.19269 WP_003099687.1.19346 WP_003099687.1.19351 WP_003099687.1.19376 WP_003099687.1.1938 WP_003099687.1.19552 WP_003099687.1.19591 WP_003099687.1.19640 WP_003099687.1.19703 WP_003099687.1.1971 WP_003099687.1.19711 WP_003099687.1.19718 WP_003099687.1.19741 WP_003099687.1.19771 WP_003099687.1.19803 WP_003099687.1.19824 WP_003099687.1.19930 WP_003099687.1.19931 WP_003099687.1.20024 WP_003099687.1.20070 WP_003099687.1.2012 WP_003099687.1.20125 WP_003099687.1.20134 WP_003099687.1.20154 WP_003099687.1.20216 WP_003099687.1.20342 WP_003099687.1.20682 WP_003099687.1.20692 WP_003099687.1.20744 WP_003099687.1.20764 WP_003099687.1.20825 WP_003099687.1.20854 WP_003099687.1.20880 WP_003099687.1.20884 WP_003099687.1.20890 WP_003099687.1.209 WP_003099687.1.20929 WP_003099687.1.20978 WP_003099687.1.21039 WP_003099687.1.21096 WP_003099687.1.21100 WP_003099687.1.21166 WP_003099687.1.21209 WP_003099687.1.21242 WP_003099687.1.21253 WP_003099687.1.21302 WP_003099687.1.21349 WP_003099687.1.21358 WP_003099687.1.2144 WP_003099687.1.21448 WP_003099687.1.21460 WP_003099687.1.21469 WP_003099687.1.21471 WP_003099687.1.21517 WP_003099687.1.21607 WP_003099687.1.21718 WP_003099687.1.2172 WP_003099687.1.21744 WP_003099687.1.21767 WP_003099687.1.21782 WP_003099687.1.21801 WP_003099687.1.21863 WP_003099687.1.21871 WP_003099687.1.21891 WP_003099687.1.21932 WP_003099687.1.22078 WP_003099687.1.221 WP_003099687.1.2228 WP_003099687.1.22316 WP_003099687.1.22324 WP_003099687.1.22365 WP_003099687.1.22389 WP_003099687.1.22390 WP_003099687.1.22394 WP_003099687.1.22442 WP_003099687.1.22477 WP_003099687.1.22491 WP_003099687.1.22573 WP_003099687.1.22671 WP_003099687.1.22704 WP_003099687.1.22729 WP_003099687.1.22863 WP_003099687.1.2289 WP_003099687.1.22891 WP_003099687.1.23013 WP_003099687.1.23166 WP_003099687.1.23195 WP_003099687.1.2323 WP_003099687.1.23264 WP_003099687.1.23331 WP_003099687.1.23394 WP_003099687.1.23418 WP_003099687.1.23421 WP_003099687.1.23512 WP_003099687.1.23518 WP_003099687.1.23523 WP_003099687.1.23525 WP_003099687.1.2355 WP_003099687.1.23559 WP_003099687.1.23581 WP_003099687.1.236 WP_003099687.1.23611 WP_003099687.1.23641 WP_003099687.1.23715 WP_003099687.1.23739 WP_003099687.1.2374 WP_003099687.1.23769 WP_003099687.1.23782 WP_003099687.1.23794 WP_003099687.1.23884 WP_003099687.1.23925 WP_003099687.1.23938 WP_003099687.1.23961 WP_003099687.1.23967 WP_003099687.1.23983 WP_003099687.1.24066 WP_003099687.1.24077 WP_003099687.1.24087 WP_003099687.1.24101 WP_003099687.1.24183 WP_003099687.1.24234 WP_003099687.1.24319 WP_003099687.1.24351 WP_003099687.1.24382 WP_003099687.1.24413 WP_003099687.1.24447 WP_003099687.1.2453 WP_003099687.1.24626 WP_003099687.1.24662 WP_003099687.1.2477 WP_003099687.1.24851 WP_003099687.1.24862 WP_003099687.1.24869 WP_003099687.1.24879 WP_003099687.1.24938 WP_003099687.1.24940 WP_003099687.1.25033 WP_003099687.1.25052 WP_003099687.1.25067 WP_003099687.1.25075 WP_003099687.1.251 WP_003099687.1.25109 WP_003099687.1.25142 WP_003099687.1.25149 WP_003099687.1.25179 WP_003099687.1.25191 WP_003099687.1.25271 WP_003099687.1.2529 WP_003099687.1.2530 WP_003099687.1.25328 WP_003099687.1.25344 WP_003099687.1.25348 WP_003099687.1.2535 WP_003099687.1.25477 WP_003099687.1.25532 WP_003099687.1.25600 WP_003099687.1.25675 WP_003099687.1.2572 WP_003099687.1.25834 WP_003099687.1.25903 WP_003099687.1.2596 WP_003099687.1.25964 WP_003099687.1.26010 WP_003099687.1.26042 WP_003099687.1.261 WP_003099687.1.26159 WP_003099687.1.26301 WP_003099687.1.26334 WP_003099687.1.26428 WP_003099687.1.26463 WP_003099687.1.26473 WP_003099687.1.26489 WP_003099687.1.2652 WP_003099687.1.26539 WP_003099687.1.26553 WP_003099687.1.26592 WP_003099687.1.26604 WP_003099687.1.26681 WP_003099687.1.26682 WP_003099687.1.26705 WP_003099687.1.26740 WP_003099687.1.26816 WP_003099687.1.26841 WP_003099687.1.26862 WP_003099687.1.26906 WP_003099687.1.26967 WP_003099687.1.2698 WP_003099687.1.27018 WP_003099687.1.27039 WP_003099687.1.27073 WP_003099687.1.27107 WP_003099687.1.27211 WP_003099687.1.27218 WP_003099687.1.27259 WP_003099687.1.27505 WP_003099687.1.27534 WP_003099687.1.27575 WP_003099687.1.27587 WP_003099687.1.27687 WP_003099687.1.27738 WP_003099687.1.27772 WP_003099687.1.27783 WP_003099687.1.27825 WP_003099687.1.27837 WP_003099687.1.27858 WP_003099687.1.27933 WP_003099687.1.27939 WP_003099687.1.27966 WP_003099687.1.28006 WP_003099687.1.28057 WP_003099687.1.28064 WP_003099687.1.28078 WP_003099687.1.28136 WP_003099687.1.28175 WP_003099687.1.28193 WP_003099687.1.28258 WP_003099687.1.283 WP_003099687.1.28316 WP_003099687.1.28329 WP_003099687.1.28372 WP_003099687.1.28382 WP_003099687.1.28383 WP_003099687.1.28404 WP_003099687.1.28468 WP_003099687.1.28505 WP_003099687.1.28528 WP_003099687.1.28560 WP_003099687.1.28602 WP_003099687.1.28623 WP_003099687.1.28699 WP_003099687.1.28713 WP_003099687.1.28757 WP_003099687.1.28800 WP_003099687.1.28823 WP_003099687.1.28838 WP_003099687.1.28849 WP_003099687.1.28920 WP_003099687.1.29003 WP_003099687.1.29062 WP_003099687.1.29096 WP_003099687.1.29127 WP_003099687.1.29137 WP_003099687.1.29158 WP_003099687.1.29179 WP_003099687.1.29208 WP_003099687.1.2927 WP_003099687.1.29401 WP_003099687.1.2941 WP_003099687.1.29438 WP_003099687.1.29440 WP_003099687.1.29472 WP_003099687.1.2948 WP_003099687.1.29481 WP_003099687.1.29498 WP_003099687.1.29501 WP_003099687.1.29577 WP_003099687.1.2961 WP_003099687.1.29633 WP_003099687.1.29668 WP_003099687.1.29753 WP_003099687.1.29767 WP_003099687.1.29848 WP_003099687.1.29920 WP_003099687.1.29958 WP_003099687.1.29973 WP_003099687.1.30000 WP_003099687.1.30081 WP_003099687.1.30120 WP_003099687.1.30254 WP_003099687.1.30365 WP_003099687.1.30474 WP_003099687.1.30475 WP_003099687.1.30563 WP_003099687.1.30567 WP_003099687.1.30614 WP_003099687.1.30615 WP_003099687.1.30625 WP_003099687.1.30693 WP_003099687.1.30707 WP_003099687.1.3072 WP_003099687.1.30740 WP_003099687.1.30797 WP_003099687.1.30815 WP_003099687.1.30886 WP_003099687.1.30943 WP_003099687.1.30994 WP_003099687.1.31045 WP_003099687.1.31076 WP_003099687.1.31087 WP_003099687.1.31103 WP_003099687.1.31105 WP_003099687.1.31138 WP_003099687.1.31147 WP_003099687.1.31279 WP_003099687.1.31361 WP_003099687.1.31457 WP_003099687.1.31501 WP_003099687.1.31563 WP_003099687.1.31565 WP_003099687.1.31587 WP_003099687.1.31655 WP_003099687.1.3172 WP_003099687.1.31732 WP_003099687.1.31741 WP_003099687.1.3179 WP_003099687.1.31848 WP_003099687.1.31852 WP_003099687.1.3189 WP_003099687.1.319 WP_003099687.1.31939 WP_003099687.1.32134 WP_003099687.1.32137 WP_003099687.1.32144 WP_003099687.1.32289 WP_003099687.1.32314 WP_003099687.1.32359 WP_003099687.1.32447 WP_003099687.1.32523 WP_003099687.1.32544 WP_003099687.1.32596 WP_003099687.1.32637 WP_003099687.1.32711 WP_003099687.1.32821 WP_003099687.1.32869 WP_003099687.1.32879 WP_003099687.1.32998 WP_003099687.1.33009 WP_003099687.1.33047 WP_003099687.1.33097 WP_003099687.1.33133 WP_003099687.1.33152 WP_003099687.1.33186 WP_003099687.1.33204 WP_003099687.1.33210 WP_003099687.1.33216 WP_003099687.1.33294 WP_003099687.1.33340 WP_003099687.1.33387 WP_003099687.1.33438 WP_003099687.1.33441 WP_003099687.1.33455 WP_003099687.1.3351 WP_003099687.1.33517 WP_003099687.1.33521 WP_003099687.1.33523 WP_003099687.1.33547 WP_003099687.1.33549 WP_003099687.1.33653 WP_003099687.1.33658 WP_003099687.1.33669 WP_003099687.1.3368 WP_003099687.1.33733 WP_003099687.1.33734 WP_003099687.1.3376 WP_003099687.1.33774 WP_003099687.1.33801 WP_003099687.1.33814 WP_003099687.1.33822 WP_003099687.1.33824 WP_003099687.1.33833 WP_003099687.1.3385 WP_003099687.1.34000 WP_003099687.1.34039 WP_003099687.1.34136 WP_003099687.1.34143 WP_003099687.1.34151 WP_003099687.1.34180 WP_003099687.1.34191 WP_003099687.1.34203 WP_003099687.1.34306 WP_003099687.1.34317 WP_003099687.1.34324 WP_003099687.1.3436 WP_003099687.1.34401 WP_003099687.1.34402 WP_003099687.1.34461 WP_003099687.1.34465 WP_003099687.1.34472 WP_003099687.1.3452 WP_003099687.1.34556 WP_003099687.1.34568 WP_003099687.1.34583 WP_003099687.1.34625 WP_003099687.1.34670 WP_003099687.1.34689 WP_003099687.1.34784 WP_003099687.1.34821 WP_003099687.1.34832 WP_003099687.1.34836 WP_003099687.1.34837 WP_003099687.1.34876 WP_003099687.1.34878 WP_003099687.1.34901 WP_003099687.1.34922 WP_003099687.1.34942 WP_003099687.1.35036 WP_003099687.1.35149 WP_003099687.1.35231 WP_003099687.1.35281 WP_003099687.1.3531 WP_003099687.1.35325 WP_003099687.1.35353 WP_003099687.1.3540 WP_003099687.1.35431 WP_003099687.1.35442 WP_003099687.1.35480 WP_003099687.1.35512 WP_003099687.1.35573 WP_003099687.1.35599 WP_003099687.1.35639 WP_003099687.1.35669 WP_003099687.1.35679 WP_003099687.1.3568 WP_003099687.1.35682 WP_003099687.1.3576 WP_003099687.1.35762 WP_003099687.1.35768 WP_003099687.1.35822 WP_003099687.1.35843 WP_003099687.1.35857 WP_003099687.1.35872 WP_003099687.1.35968 WP_003099687.1.35984 WP_003099687.1.36064 WP_003099687.1.36121 WP_003099687.1.36148 WP_003099687.1.36170 WP_003099687.1.36267 WP_003099687.1.36378 WP_003099687.1.36435 WP_003099687.1.36487 WP_003099687.1.36521 WP_003099687.1.3653 WP_003099687.1.36587 WP_003099687.1.36608 WP_003099687.1.3662 WP_003099687.1.36630 WP_003099687.1.36665 WP_003099687.1.36708 WP_003099687.1.3672 WP_003099687.1.36756 WP_003099687.1.36781 WP_003099687.1.36879 WP_003099687.1.37050 WP_003099687.1.37097 WP_003099687.1.37125 WP_003099687.1.37163 WP_003099687.1.37172 WP_003099687.1.37208 WP_003099687.1.3721 WP_003099687.1.37216 WP_003099687.1.373 WP_003099687.1.37319 WP_003099687.1.37366 WP_003099687.1.37416 WP_003099687.1.37500 WP_003099687.1.37512 WP_003099687.1.37571 WP_003099687.1.3768 WP_003099687.1.37698 WP_003099687.1.37703 WP_003099687.1.3773 WP_003099687.1.37799 WP_003099687.1.3781 WP_003099687.1.37814 WP_003099687.1.37818 WP_003099687.1.37826 WP_003099687.1.37842 WP_003099687.1.3785 WP_003099687.1.3792 WP_003099687.1.38003 WP_003099687.1.38023 WP_003099687.1.38060 WP_003099687.1.38087 WP_003099687.1.38102 WP_003099687.1.38146 WP_003099687.1.38151 WP_003099687.1.3818 WP_003099687.1.38186 WP_003099687.1.3821 WP_003099687.1.3833 WP_003099687.1.38337 WP_003099687.1.38406 WP_003099687.1.38430 WP_003099687.1.38450 WP_003099687.1.38502 WP_003099687.1.38505 WP_003099687.1.38510 WP_003099687.1.38582 WP_003099687.1.38583 WP_003099687.1.38587 WP_003099687.1.38657 WP_003099687.1.38661 WP_003099687.1.3870 WP_003099687.1.38706 WP_003099687.1.38727 WP_003099687.1.38816 WP_003099687.1.38834 WP_003099687.1.3887 WP_003099687.1.38889 WP_003099687.1.38932 WP_003099687.1.38971 WP_003099687.1.39046 WP_003099687.1.39088 WP_003099687.1.39122 WP_003099687.1.39186 WP_003099687.1.39271 WP_003099687.1.39326 WP_003099687.1.39345 WP_003099687.1.3943 WP_003099687.1.39444 WP_003099687.1.39452 WP_003099687.1.39458 WP_003099687.1.39537 WP_003099687.1.39765 WP_003099687.1.39786 WP_003099687.1.39811 WP_003099687.1.39949 WP_003099687.1.3998 WP_003099687.1.39989 WP_003099687.1.40059 WP_003099687.1.40115 WP_003099687.1.40135 WP_003099687.1.40207 WP_003099687.1.40213 WP_003099687.1.40237 WP_003099687.1.40243 WP_003099687.1.4038 WP_003099687.1.40419 WP_003099687.1.40442 WP_003099687.1.40512 WP_003099687.1.40513 WP_003099687.1.40541 WP_003099687.1.40546 WP_003099687.1.4058 WP_003099687.1.40595 WP_003099687.1.40703 WP_003099687.1.40874 WP_003099687.1.40984 WP_003099687.1.40993 WP_003099687.1.40994 WP_003099687.1.41110 WP_003099687.1.41290 WP_003099687.1.41291 WP_003099687.1.41301 WP_003099687.1.41384 WP_003099687.1.41412 WP_003099687.1.41429 WP_003099687.1.41487 WP_003099687.1.41492 WP_003099687.1.41502 WP_003099687.1.4156 WP_003099687.1.41618 WP_003099687.1.41624 WP_003099687.1.41625 WP_003099687.1.41692 WP_003099687.1.41703 WP_003099687.1.41725 WP_003099687.1.41732 WP_003099687.1.41748 WP_003099687.1.41773 WP_003099687.1.41832 WP_003099687.1.41846 WP_003099687.1.41871 WP_003099687.1.41888 WP_003099687.1.4190 WP_003099687.1.41939 WP_003099687.1.4196 WP_003099687.1.42 WP_003099687.1.42019 WP_003099687.1.42041 WP_003099687.1.42047 WP_003099687.1.42146 WP_003099687.1.42259 WP_003099687.1.42294 WP_003099687.1.42316 WP_003099687.1.42381 WP_003099687.1.42388 WP_003099687.1.42411 WP_003099687.1.42423 WP_003099687.1.42463 WP_003099687.1.42499 WP_003099687.1.42508 WP_003099687.1.42634 WP_003099687.1.42643 WP_003099687.1.42696 WP_003099687.1.42754 WP_003099687.1.42757 WP_003099687.1.42778 WP_003099687.1.42789 WP_003099687.1.42854 WP_003099687.1.42856 WP_003099687.1.42870 WP_003099687.1.42917 WP_003099687.1.42946 WP_003099687.1.42952 WP_003099687.1.42972 WP_003099687.1.42973 WP_003099687.1.43022 WP_003099687.1.43024 WP_003099687.1.43026 WP_003099687.1.43049 WP_003099687.1.43107 WP_003099687.1.43245 WP_003099687.1.43286 WP_003099687.1.43293 WP_003099687.1.43315 WP_003099687.1.43330 WP_003099687.1.43356 WP_003099687.1.4348 WP_003099687.1.43593 WP_003099687.1.43603 WP_003099687.1.43662 WP_003099687.1.43667 WP_003099687.1.43673 WP_003099687.1.43696 WP_003099687.1.43729 WP_003099687.1.43756 WP_003099687.1.43783 WP_003099687.1.43802 WP_003099687.1.4381 WP_003099687.1.43811 WP_003099687.1.43826 WP_003099687.1.4397 WP_003099687.1.4398 WP_003099687.1.43998 WP_003099687.1.44046 WP_003099687.1.44094 WP_003099687.1.44213 WP_003099687.1.44260 WP_003099687.1.44373 WP_003099687.1.44434 WP_003099687.1.44486 WP_003099687.1.445 WP_003099687.1.44563 WP_003099687.1.44565 WP_003099687.1.44581 WP_003099687.1.44725 WP_003099687.1.44739 WP_003099687.1.44760 WP_003099687.1.4493 WP_003099687.1.44959 WP_003099687.1.45063 WP_003099687.1.45090 WP_003099687.1.45146 WP_003099687.1.45199 WP_003099687.1.45202 WP_003099687.1.4522 WP_003099687.1.45228 WP_003099687.1.45298 WP_003099687.1.45306 WP_003099687.1.45312 WP_003099687.1.4532 WP_003099687.1.45328 WP_003099687.1.45353 WP_003099687.1.45358 WP_003099687.1.45464 WP_003099687.1.45478 WP_003099687.1.45485 WP_003099687.1.45604 WP_003099687.1.45635 WP_003099687.1.45636 WP_003099687.1.45678 WP_003099687.1.45700 WP_003099687.1.45711 WP_003099687.1.45723 WP_003099687.1.45818 WP_003099687.1.45837 WP_003099687.1.45934 WP_003099687.1.45961 WP_003099687.1.46010 WP_003099687.1.46032 WP_003099687.1.46093 WP_003099687.1.461 WP_003099687.1.46152 WP_003099687.1.46200 WP_003099687.1.46306 WP_003099687.1.46436 WP_003099687.1.46502 WP_003099687.1.46623 WP_003099687.1.46633 WP_003099687.1.46755 WP_003099687.1.46787 WP_003099687.1.46826 WP_003099687.1.46846 WP_003099687.1.46866 WP_003099687.1.46885 WP_003099687.1.46926 WP_003099687.1.46935 WP_003099687.1.4699 WP_003099687.1.47101 WP_003099687.1.47150 WP_003099687.1.47155 WP_003099687.1.47158 WP_003099687.1.47251 WP_003099687.1.4726 WP_003099687.1.47296 WP_003099687.1.47312 WP_003099687.1.47314 WP_003099687.1.47374 WP_003099687.1.47469 WP_003099687.1.47480 WP_003099687.1.47527 WP_003099687.1.47598 WP_003099687.1.47645 WP_003099687.1.47774 WP_003099687.1.47930 WP_003099687.1.47934 WP_003099687.1.47970 WP_003099687.1.48001 WP_003099687.1.48024 WP_003099687.1.48086 WP_003099687.1.48094 WP_003099687.1.48141 WP_003099687.1.48172 WP_003099687.1.48178 WP_003099687.1.48321 WP_003099687.1.48334 WP_003099687.1.4836 WP_003099687.1.48378 WP_003099687.1.48382 WP_003099687.1.48413 WP_003099687.1.48472 WP_003099687.1.48474 WP_003099687.1.48487 WP_003099687.1.48545 WP_003099687.1.48546 WP_003099687.1.48576 WP_003099687.1.48747 WP_003099687.1.48810 WP_003099687.1.48820 WP_003099687.1.48842 WP_003099687.1.48851 WP_003099687.1.48870 WP_003099687.1.48961 WP_003099687.1.49108 WP_003099687.1.4913 WP_003099687.1.49135 WP_003099687.1.49184 WP_003099687.1.49244 WP_003099687.1.49265 WP_003099687.1.49266 WP_003099687.1.49277 WP_003099687.1.49286 WP_003099687.1.49293 WP_003099687.1.49360 WP_003099687.1.49416 WP_003099687.1.49500 WP_003099687.1.49557 WP_003099687.1.49566 WP_003099687.1.49688 WP_003099687.1.49798 WP_003099687.1.49806 WP_003099687.1.49833 WP_003099687.1.49842 WP_003099687.1.49922 WP_003099687.1.49948 WP_003099687.1.49976 WP_003099687.1.49988 WP_003099687.1.49998 WP_003099687.1.50176 WP_003099687.1.50180 WP_003099687.1.50222 WP_003099687.1.50232 WP_003099687.1.50242 WP_003099687.1.5043 WP_003099687.1.50459 WP_003099687.1.50567 WP_003099687.1.50653 WP_003099687.1.50665 WP_003099687.1.50668 WP_003099687.1.50682 WP_003099687.1.50691 WP_003099687.1.50734 WP_003099687.1.50783 WP_003099687.1.50814 WP_003099687.1.50922 WP_003099687.1.50967 WP_003099687.1.50989 WP_003099687.1.51019 WP_003099687.1.51035 WP_003099687.1.51136 WP_003099687.1.51141 WP_003099687.1.51173 WP_003099687.1.51183 WP_003099687.1.51185 WP_003099687.1.51267 WP_003099687.1.51273 WP_003099687.1.5132 WP_003099687.1.51457 WP_003099687.1.51472 WP_003099687.1.51501 WP_003099687.1.51538 WP_003099687.1.51549 WP_003099687.1.51585 WP_003099687.1.51682 WP_003099687.1.51727 WP_003099687.1.51733 WP_003099687.1.51807 WP_003099687.1.51847 WP_003099687.1.51889 WP_003099687.1.51917 WP_003099687.1.51928 WP_003099687.1.51943 WP_003099687.1.51957 WP_003099687.1.51976 WP_003099687.1.52043 WP_003099687.1.52146 WP_003099687.1.52152 WP_003099687.1.52212 WP_003099687.1.52220 WP_003099687.1.52244 WP_003099687.1.5226 WP_003099687.1.52326 WP_003099687.1.52334 WP_003099687.1.5235 WP_003099687.1.52355 WP_003099687.1.52409 WP_003099687.1.52449 WP_003099687.1.52500 WP_003099687.1.52537 WP_003099687.1.5258 WP_003099687.1.52583 WP_003099687.1.5260 WP_003099687.1.52690 WP_003099687.1.52697 WP_003099687.1.52700 WP_003099687.1.52784 WP_003099687.1.52790 WP_003099687.1.52810 WP_003099687.1.52850 WP_003099687.1.5294 WP_003099687.1.53037 WP_003099687.1.53038 WP_003099687.1.53070 WP_003099687.1.53072 WP_003099687.1.53169 WP_003099687.1.53267 WP_003099687.1.53287 WP_003099687.1.53351 WP_003099687.1.53371 WP_003099687.1.53414 WP_003099687.1.53427 WP_003099687.1.53486 WP_003099687.1.53528 WP_003099687.1.53530 WP_003099687.1.53663 WP_003099687.1.53678 WP_003099687.1.53719 WP_003099687.1.53726 WP_003099687.1.53826 WP_003099687.1.5388 WP_003099687.1.53932 WP_003099687.1.53948 WP_003099687.1.53951 WP_003099687.1.5399 WP_003099687.1.54003 WP_003099687.1.54090 WP_003099687.1.54133 WP_003099687.1.54140 WP_003099687.1.54146 WP_003099687.1.54248 WP_003099687.1.5427 WP_003099687.1.54293 WP_003099687.1.54354 WP_003099687.1.54462 WP_003099687.1.54497 WP_003099687.1.54571 WP_003099687.1.54742 WP_003099687.1.54809 WP_003099687.1.54974 WP_003099687.1.55089 WP_003099687.1.55169 WP_003099687.1.55318 WP_003099687.1.55347 WP_003099687.1.55387 WP_003099687.1.55400 WP_003099687.1.55445 WP_003099687.1.55478 WP_003099687.1.55543 WP_003099687.1.55729 WP_003099687.1.55813 WP_003099687.1.55976 WP_003099687.1.56013 WP_003099687.1.56037 WP_003099687.1.56145 WP_003099687.1.56171 WP_003099687.1.56187 WP_003099687.1.56188 WP_003099687.1.56196 WP_003099687.1.56228 WP_003099687.1.56229 WP_003099687.1.56315 WP_003099687.1.56348 WP_003099687.1.56442 WP_003099687.1.56452 WP_003099687.1.56465 WP_003099687.1.56474 WP_003099687.1.56475 WP_003099687.1.56623 WP_003099687.1.56626 WP_003099687.1.56632 WP_003099687.1.56745 WP_003099687.1.56768 WP_003099687.1.56797 WP_003099687.1.56808 WP_003099687.1.56819 WP_003099687.1.56837 WP_003099687.1.56864 WP_003099687.1.56896 WP_003099687.1.56973 WP_003099687.1.57005 WP_003099687.1.57020 WP_003099687.1.57113 WP_003099687.1.57131 WP_003099687.1.57140 WP_003099687.1.57276 WP_003099687.1.5731 WP_003099687.1.57339 WP_003099687.1.57369 WP_003099687.1.57417 WP_003099687.1.57460 WP_003099687.1.57477 WP_003099687.1.57480 WP_003099687.1.57548 WP_003099687.1.57566 WP_003099687.1.57792 WP_003099687.1.57839 WP_003099687.1.57841 WP_003099687.1.57853 WP_003099687.1.57966 WP_003099687.1.58019 WP_003099687.1.58155 WP_003099687.1.58162 WP_003099687.1.58183 WP_003099687.1.58193 WP_003099687.1.58200 WP_003099687.1.58228 WP_003099687.1.58294 WP_003099687.1.58360 WP_003099687.1.58417 WP_003099687.1.58436 WP_003099687.1.58482 WP_003099687.1.5850 WP_003099687.1.58510 WP_003099687.1.58527 WP_003099687.1.5856 WP_003099687.1.58689 WP_003099687.1.5869 WP_003099687.1.58785 WP_003099687.1.58800 WP_003099687.1.58838 WP_003099687.1.58845 WP_003099687.1.5889 WP_003099687.1.58944 WP_003099687.1.58952 WP_003099687.1.59013 WP_003099687.1.59076 WP_003099687.1.59099 WP_003099687.1.59123 WP_003099687.1.59156 WP_003099687.1.59158 WP_003099687.1.59176 WP_003099687.1.59212 WP_003099687.1.59246 WP_003099687.1.59249 WP_003099687.1.59250 WP_003099687.1.59288 WP_003099687.1.5937 WP_003099687.1.59376 WP_003099687.1.594 WP_003099687.1.59469 WP_003099687.1.59563 WP_003099687.1.59688 WP_003099687.1.59724 WP_003099687.1.59797 WP_003099687.1.59831 WP_003099687.1.59870 WP_003099687.1.60051 WP_003099687.1.60062 WP_003099687.1.60079 WP_003099687.1.60082 WP_003099687.1.60084 WP_003099687.1.60206 WP_003099687.1.60261 WP_003099687.1.60364 WP_003099687.1.60396 WP_003099687.1.60415 WP_003099687.1.60467 WP_003099687.1.60472 WP_003099687.1.60509 WP_003099687.1.60600 WP_003099687.1.60602 WP_003099687.1.60603 WP_003099687.1.60639 WP_003099687.1.60679 WP_003099687.1.60686 WP_003099687.1.607 WP_003099687.1.60850 WP_003099687.1.60910 WP_003099687.1.60916 WP_003099687.1.60970 WP_003099687.1.60979 WP_003099687.1.61122 WP_003099687.1.61130 WP_003099687.1.61191 WP_003099687.1.61209 WP_003099687.1.61222 WP_003099687.1.61269 WP_003099687.1.61288 WP_003099687.1.61294 WP_003099687.1.61299 WP_003099687.1.6130 WP_003099687.1.61366 WP_003099687.1.61431 WP_003099687.1.61493 WP_003099687.1.61549 WP_003099687.1.61589 WP_003099687.1.61598 WP_003099687.1.61696 WP_003099687.1.6173 WP_003099687.1.61943 WP_003099687.1.62010 WP_003099687.1.62035 WP_003099687.1.62180 WP_003099687.1.62186 WP_003099687.1.62211 WP_003099687.1.62263 WP_003099687.1.62357 WP_003099687.1.62396 WP_003099687.1.62410 WP_003099687.1.6242 WP_003099687.1.62483 WP_003099687.1.62516 WP_003099687.1.62534 WP_003099687.1.626 WP_003099687.1.62604 WP_003099687.1.62635 WP_003099687.1.62701 WP_003099687.1.62703 WP_003099687.1.62704 WP_003099687.1.62708 WP_003099687.1.62716 WP_003099687.1.62768 WP_003099687.1.6280 WP_003099687.1.6283 WP_003099687.1.62834 WP_003099687.1.62838 WP_003099687.1.62873 WP_003099687.1.62917 WP_003099687.1.62977 WP_003099687.1.63038 WP_003099687.1.63041 WP_003099687.1.63057 WP_003099687.1.63124 WP_003099687.1.63193 WP_003099687.1.63196 WP_003099687.1.63338 WP_003099687.1.63369 WP_003099687.1.63401 WP_003099687.1.63591 WP_003099687.1.63597 WP_003099687.1.63634 WP_003099687.1.63659 WP_003099687.1.63739 WP_003099687.1.63784 WP_003099687.1.63995 WP_003099687.1.64155 WP_003099687.1.64198 WP_003099687.1.64212 WP_003099687.1.64309 WP_003099687.1.64329 WP_003099687.1.64340 WP_003099687.1.64433 WP_003099687.1.6450 WP_003099687.1.64544 WP_003099687.1.64591 WP_003099687.1.64603 WP_003099687.1.6461 WP_003099687.1.64726 WP_003099687.1.64748 WP_003099687.1.64799 WP_003099687.1.64807 WP_003099687.1.64854 WP_003099687.1.64862 WP_003099687.1.64880 WP_003099687.1.64885 WP_003099687.1.64886 WP_003099687.1.64983 WP_003099687.1.64984 WP_003099687.1.65009 WP_003099687.1.65066 WP_003099687.1.65092 WP_003099687.1.65095 WP_003099687.1.65099 WP_003099687.1.65145 WP_003099687.1.65196 WP_003099687.1.65197 WP_003099687.1.65227 WP_003099687.1.65237 WP_003099687.1.65247 WP_003099687.1.65285 WP_003099687.1.65304 WP_003099687.1.65312 WP_003099687.1.65316 WP_003099687.1.65334 WP_003099687.1.65335 WP_003099687.1.65337 WP_003099687.1.65457 WP_003099687.1.65549 WP_003099687.1.65588 WP_003099687.1.65632 WP_003099687.1.65642 WP_003099687.1.65679 WP_003099687.1.65740 WP_003099687.1.65779 WP_003099687.1.65819 WP_003099687.1.65867 WP_003099687.1.6589 WP_003099687.1.65926 WP_003099687.1.66062 WP_003099687.1.66155 WP_003099687.1.66165 WP_003099687.1.6627 WP_003099687.1.66277 WP_003099687.1.6629 WP_003099687.1.66345 WP_003099687.1.66364 WP_003099687.1.66371 WP_003099687.1.66410 WP_003099687.1.66526 WP_003099687.1.66563 WP_003099687.1.66634 WP_003099687.1.66721 WP_003099687.1.66892 WP_003099687.1.66929 WP_003099687.1.66931 WP_003099687.1.66945 WP_003099687.1.66950 WP_003099687.1.66982 WP_003099687.1.67010 WP_003099687.1.67188 WP_003099687.1.67192 WP_003099687.1.67205 WP_003099687.1.67261 WP_003099687.1.67269 WP_003099687.1.6734 WP_003099687.1.67370 WP_003099687.1.67388 WP_003099687.1.67472 WP_003099687.1.67489 WP_003099687.1.67506 WP_003099687.1.67526 WP_003099687.1.67531 WP_003099687.1.67545 WP_003099687.1.6768 WP_003099687.1.67686 WP_003099687.1.67755 WP_003099687.1.67830 WP_003099687.1.67875 WP_003099687.1.67899 WP_003099687.1.67903 WP_003099687.1.67937 WP_003099687.1.67948 WP_003099687.1.68000 WP_003099687.1.6808 WP_003099687.1.68158 WP_003099687.1.68162 WP_003099687.1.68172 WP_003099687.1.68183 WP_003099687.1.68194 WP_003099687.1.68252 WP_003099687.1.68317 WP_003099687.1.68472 WP_003099687.1.68499 WP_003099687.1.6850 WP_003099687.1.68541 WP_003099687.1.68568 WP_003099687.1.68638 WP_003099687.1.6866 WP_003099687.1.68756 WP_003099687.1.68781 WP_003099687.1.68790 WP_003099687.1.68800 WP_003099687.1.68802 WP_003099687.1.68850 WP_003099687.1.68857 WP_003099687.1.68862 WP_003099687.1.68881 WP_003099687.1.68910 WP_003099687.1.68938 WP_003099687.1.68979 WP_003099687.1.69088 WP_003099687.1.6911 WP_003099687.1.69159 WP_003099687.1.69209 WP_003099687.1.69260 WP_003099687.1.6928 WP_003099687.1.6931 WP_003099687.1.69330 WP_003099687.1.6937 WP_003099687.1.69411 WP_003099687.1.69534 WP_003099687.1.69556 WP_003099687.1.69599 WP_003099687.1.69702 WP_003099687.1.69788 WP_003099687.1.69791 WP_003099687.1.69819 WP_003099687.1.69834 WP_003099687.1.69907 WP_003099687.1.69993 WP_003099687.1.70092 WP_003099687.1.70098 WP_003099687.1.70138 WP_003099687.1.70168 WP_003099687.1.70194 WP_003099687.1.70216 WP_003099687.1.70229 WP_003099687.1.70331 WP_003099687.1.70470 WP_003099687.1.70537 WP_003099687.1.70561 WP_003099687.1.70583 WP_003099687.1.70648 WP_003099687.1.70670 WP_003099687.1.70677 WP_003099687.1.70693 WP_003099687.1.7077 WP_003099687.1.70778 WP_003099687.1.70831 WP_003099687.1.70991 WP_003099687.1.71038 WP_003099687.1.71141 WP_003099687.1.71203 WP_003099687.1.71234 WP_003099687.1.71249 WP_003099687.1.71254 WP_003099687.1.7128 WP_003099687.1.71346 WP_003099687.1.71385 WP_003099687.1.71412 WP_003099687.1.71570 WP_003099687.1.7163 WP_003099687.1.71642 WP_003099687.1.71666 WP_003099687.1.71738 WP_003099687.1.71799 WP_003099687.1.71806 WP_003099687.1.71822 WP_003099687.1.71862 WP_003099687.1.71866 WP_003099687.1.71891 WP_003099687.1.71927 WP_003099687.1.71934 WP_003099687.1.72149 WP_003099687.1.72167 WP_003099687.1.72181 WP_003099687.1.72183 WP_003099687.1.72287 WP_003099687.1.72323 WP_003099687.1.72331 WP_003099687.1.72346 WP_003099687.1.72378 WP_003099687.1.72447 WP_003099687.1.72458 WP_003099687.1.72477 WP_003099687.1.72541 WP_003099687.1.72562 WP_003099687.1.72653 WP_003099687.1.72669 WP_003099687.1.72727 WP_003099687.1.7276 WP_003099687.1.72768 WP_003099687.1.72772 WP_003099687.1.72845 WP_003099687.1.72920 WP_003099687.1.73048 WP_003099687.1.7308 WP_003099687.1.73135 WP_003099687.1.73149 WP_003099687.1.73172 WP_003099687.1.73192 WP_003099687.1.7327 WP_003099687.1.7329 WP_003099687.1.733 WP_003099687.1.73455 WP_003099687.1.73523 WP_003099687.1.73541 WP_003099687.1.73601 WP_003099687.1.73719 WP_003099687.1.73728 WP_003099687.1.7377 WP_003099687.1.73791 WP_003099687.1.7382 WP_003099687.1.73860 WP_003099687.1.73889 WP_003099687.1.73911 WP_003099687.1.73941 WP_003099687.1.74 WP_003099687.1.74000 WP_003099687.1.74072 WP_003099687.1.74074 WP_003099687.1.7408 WP_003099687.1.74106 WP_003099687.1.74167 WP_003099687.1.74175 WP_003099687.1.74180 WP_003099687.1.74182 WP_003099687.1.74219 WP_003099687.1.74264 WP_003099687.1.74268 WP_003099687.1.74281 WP_003099687.1.74287 WP_003099687.1.74326 WP_003099687.1.7445 WP_003099687.1.74458 WP_003099687.1.74473 WP_003099687.1.74475 WP_003099687.1.7448 WP_003099687.1.74518 WP_003099687.1.7456 WP_003099687.1.74568 WP_003099687.1.74604 WP_003099687.1.74629 WP_003099687.1.74637 WP_003099687.1.74685 WP_003099687.1.74772 WP_003099687.1.748 WP_003099687.1.74878 WP_003099687.1.74941 WP_003099687.1.74948 WP_003099687.1.74958 WP_003099687.1.75041 WP_003099687.1.75119 WP_003099687.1.75204 WP_003099687.1.75277 WP_003099687.1.75303 WP_003099687.1.75431 WP_003099687.1.7547 WP_003099687.1.75549 WP_003099687.1.75573 WP_003099687.1.75580 WP_003099687.1.75599 WP_003099687.1.75603 WP_003099687.1.75631 WP_003099687.1.75771 WP_003099687.1.75792 WP_003099687.1.75825 WP_003099687.1.75826 WP_003099687.1.75860 WP_003099687.1.75935 WP_003099687.1.75938 WP_003099687.1.75947 WP_003099687.1.7595 WP_003099687.1.76077 WP_003099687.1.76092 WP_003099687.1.76141 WP_003099687.1.76145 WP_003099687.1.76322 WP_003099687.1.76355 WP_003099687.1.76383 WP_003099687.1.76399 WP_003099687.1.76441 WP_003099687.1.76467 WP_003099687.1.76484 WP_003099687.1.76543 WP_003099687.1.76600 WP_003099687.1.76633 WP_003099687.1.7666 WP_003099687.1.76716 WP_003099687.1.76775 WP_003099687.1.76791 WP_003099687.1.76861 WP_003099687.1.76922 WP_003099687.1.76985 WP_003099687.1.77235 WP_003099687.1.77238 WP_003099687.1.77286 WP_003099687.1.77317 WP_003099687.1.77476 WP_003099687.1.77490 WP_003099687.1.77566 WP_003099687.1.77574 WP_003099687.1.77587 WP_003099687.1.77686 WP_003099687.1.77750 WP_003099687.1.77769 WP_003099687.1.7779 WP_003099687.1.77819 WP_003099687.1.77834 WP_003099687.1.77913 WP_003099687.1.78104 WP_003099687.1.78118 WP_003099687.1.78134 WP_003099687.1.78148 WP_003099687.1.78158 WP_003099687.1.78280 WP_003099687.1.78288 WP_003099687.1.78380 WP_003099687.1.7840 WP_003099687.1.78409 WP_003099687.1.78425 WP_003099687.1.78430 WP_003099687.1.78437 WP_003099687.1.78570 WP_003099687.1.78669 WP_003099687.1.78693 WP_003099687.1.78795 WP_003099687.1.788 WP_003099687.1.78810 WP_003099687.1.78926 WP_003099687.1.78947 WP_003099687.1.78954 WP_003099687.1.7899 WP_003099687.1.79007 WP_003099687.1.79053 WP_003099687.1.79177 WP_003099687.1.79193 WP_003099687.1.79256 WP_003099687.1.79279 WP_003099687.1.79286 WP_003099687.1.79311 WP_003099687.1.79357 WP_003099687.1.79364 WP_003099687.1.79421 WP_003099687.1.79429 WP_003099687.1.79431 WP_003099687.1.7945 WP_003099687.1.79463 WP_003099687.1.79507 WP_003099687.1.7953 WP_003099687.1.79544 WP_003099687.1.79569 WP_003099687.1.79601 WP_003099687.1.79631 WP_003099687.1.79699 WP_003099687.1.79754 WP_003099687.1.79788 WP_003099687.1.79862 WP_003099687.1.79883 WP_003099687.1.799 WP_003099687.1.79902 WP_003099687.1.79908 WP_003099687.1.79986 WP_003099687.1.8 WP_003099687.1.80033 WP_003099687.1.80068 WP_003099687.1.80087 WP_003099687.1.80102 WP_003099687.1.8013 WP_003099687.1.80174 WP_003099687.1.80258 WP_003099687.1.8028 WP_003099687.1.80306 WP_003099687.1.8038 WP_003099687.1.80410 WP_003099687.1.80411 WP_003099687.1.80454 WP_003099687.1.80481 WP_003099687.1.8051 WP_003099687.1.80535 WP_003099687.1.80572 WP_003099687.1.80627 WP_003099687.1.80632 WP_003099687.1.8064 WP_003099687.1.80644 WP_003099687.1.80645 WP_003099687.1.80683 WP_003099687.1.80720 WP_003099687.1.80785 WP_003099687.1.80846 WP_003099687.1.80880 WP_003099687.1.80892 WP_003099687.1.80910 WP_003099687.1.80929 WP_003099687.1.80931 WP_003099687.1.80938 WP_003099687.1.80969 WP_003099687.1.81081 WP_003099687.1.81082 WP_003099687.1.8110 WP_003099687.1.81206 WP_003099687.1.81237 WP_003099687.1.81331 WP_003099687.1.81368 WP_003099687.1.81380 WP_003099687.1.81426 WP_003099687.1.81470 WP_003099687.1.81482 WP_003099687.1.81487 WP_003099687.1.81581 WP_003099687.1.81591 WP_003099687.1.81622 WP_003099687.1.81708 WP_003099687.1.81728 WP_003099687.1.81742 WP_003099687.1.81748 WP_003099687.1.81771 WP_003099687.1.81784 WP_003099687.1.81802 WP_003099687.1.81816 WP_003099687.1.81834 WP_003099687.1.81844 WP_003099687.1.81856 WP_003099687.1.81874 WP_003099687.1.81927 WP_003099687.1.81950 WP_003099687.1.81957 WP_003099687.1.81960 WP_003099687.1.81986 WP_003099687.1.82117 WP_003099687.1.82127 WP_003099687.1.82178 WP_003099687.1.82260 WP_003099687.1.8227 WP_003099687.1.82310 WP_003099687.1.82312 WP_003099687.1.82328 WP_003099687.1.82334 WP_003099687.1.8238 WP_003099687.1.82442 WP_003099687.1.82487 WP_003099687.1.82580 WP_003099687.1.82604 WP_003099687.1.82606 WP_003099687.1.82620 WP_003099687.1.82643 WP_003099687.1.82686 WP_003099687.1.82710 WP_003099687.1.82864 WP_003099687.1.82882 WP_003099687.1.82887 WP_003099687.1.82936 WP_003099687.1.83025 WP_003099687.1.83131 WP_003099687.1.83184 WP_003099687.1.83213 WP_003099687.1.83251 WP_003099687.1.83267 WP_003099687.1.83296 WP_003099687.1.83317 WP_003099687.1.83374 WP_003099687.1.83394 WP_003099687.1.83440 WP_003099687.1.83460 WP_003099687.1.83463 WP_003099687.1.835 WP_003099687.1.83503 WP_003099687.1.8353 WP_003099687.1.83534 WP_003099687.1.83540 WP_003099687.1.8357 WP_003099687.1.83637 WP_003099687.1.83673 WP_003099687.1.83698 WP_003099687.1.83715 WP_003099687.1.83946 WP_003099687.1.84003 WP_003099687.1.84008 WP_003099687.1.84138 WP_003099687.1.84162 WP_003099687.1.84174 WP_003099687.1.84177 WP_003099687.1.84178 WP_003099687.1.84190 WP_003099687.1.84203 WP_003099687.1.84271 WP_003099687.1.84297 WP_003099687.1.8437 WP_003099687.1.84374 WP_003099687.1.84398 WP_003099687.1.84404 WP_003099687.1.84439 WP_003099687.1.84471 WP_003099687.1.84487 WP_003099687.1.84526 WP_003099687.1.8453 WP_003099687.1.84538 WP_003099687.1.84558 WP_003099687.1.84589 WP_003099687.1.84674 WP_003099687.1.84684 WP_003099687.1.84702 WP_003099687.1.84715 WP_003099687.1.84754 WP_003099687.1.84792 WP_003099687.1.8484 WP_003099687.1.84865 WP_003099687.1.84937 WP_003099687.1.85018 WP_003099687.1.85028 WP_003099687.1.85059 WP_003099687.1.85150 WP_003099687.1.85220 WP_003099687.1.85290 WP_003099687.1.85298 WP_003099687.1.85311 WP_003099687.1.85318 WP_003099687.1.85357 WP_003099687.1.85446 WP_003099687.1.85453 WP_003099687.1.85633 WP_003099687.1.85638 WP_003099687.1.85788 WP_003099687.1.85897 WP_003099687.1.85910 WP_003099687.1.85920 WP_003099687.1.86002 WP_003099687.1.86047 WP_003099687.1.86055 WP_003099687.1.86058 WP_003099687.1.861 WP_003099687.1.86125 WP_003099687.1.86182 WP_003099687.1.86278 WP_003099687.1.86287 WP_003099687.1.86293 WP_003099687.1.86386 WP_003099687.1.86432 WP_003099687.1.865 WP_003099687.1.86545 WP_003099687.1.86552 WP_003099687.1.86554 WP_003099687.1.86652 WP_003099687.1.86665 WP_003099687.1.867 WP_003099687.1.86708 WP_003099687.1.86733 WP_003099687.1.86774 WP_003099687.1.86780 WP_003099687.1.86785 WP_003099687.1.86796 WP_003099687.1.86813 WP_003099687.1.86822 WP_003099687.1.8693 WP_003099687.1.86947 WP_003099687.1.86970 WP_003099687.1.86985 WP_003099687.1.87104 WP_003099687.1.87163 WP_003099687.1.8718 WP_003099687.1.87182 WP_003099687.1.87183 WP_003099687.1.8727 WP_003099687.1.87316 WP_003099687.1.87435 WP_003099687.1.87463 WP_003099687.1.8749 WP_003099687.1.87530 WP_003099687.1.87547 WP_003099687.1.87648 WP_003099687.1.87763 WP_003099687.1.8777 WP_003099687.1.8785 WP_003099687.1.87877 WP_003099687.1.87888 WP_003099687.1.87970 WP_003099687.1.87981 WP_003099687.1.87987 WP_003099687.1.88004 WP_003099687.1.88308 WP_003099687.1.88330 WP_003099687.1.88360 WP_003099687.1.88388 WP_003099687.1.88415 WP_003099687.1.88517 WP_003099687.1.8852 WP_003099687.1.88540 WP_003099687.1.88550 WP_003099687.1.88578 WP_003099687.1.88605 WP_003099687.1.88659 WP_003099687.1.88679 WP_003099687.1.88680 WP_003099687.1.88714 WP_003099687.1.88750 WP_003099687.1.88796 WP_003099687.1.889 WP_003099687.1.88949 WP_003099687.1.88969 WP_003099687.1.89083 WP_003099687.1.89098 WP_003099687.1.8911 WP_003099687.1.89234 WP_003099687.1.89245 WP_003099687.1.89266 WP_003099687.1.89276 WP_003099687.1.89330 WP_003099687.1.89409 WP_003099687.1.89434 WP_003099687.1.89480 WP_003099687.1.8949 WP_003099687.1.89491 WP_003099687.1.89523 WP_003099687.1.89577 WP_003099687.1.89610 WP_003099687.1.89638 WP_003099687.1.89662 WP_003099687.1.89669 WP_003099687.1.89736 WP_003099687.1.8976 WP_003099687.1.89776 WP_003099687.1.89805 WP_003099687.1.89866 WP_003099687.1.89867 WP_003099687.1.89868 WP_003099687.1.89871 WP_003099687.1.89886 WP_003099687.1.89992 WP_003099687.1.90024 WP_003099687.1.90032 WP_003099687.1.90056 WP_003099687.1.90110 WP_003099687.1.90141 WP_003099687.1.90150 WP_003099687.1.90189 WP_003099687.1.90224 WP_003099687.1.90225 WP_003099687.1.90242 WP_003099687.1.90268 WP_003099687.1.90306 WP_003099687.1.90412 WP_003099687.1.9056 WP_003099687.1.90569 WP_003099687.1.90655 WP_003099687.1.90770 WP_003099687.1.90940 WP_003099687.1.90999 WP_003099687.1.91093 WP_003099687.1.91161 WP_003099687.1.9120 WP_003099687.1.91204 WP_003099687.1.91281 WP_003099687.1.91307 WP_003099687.1.91336 WP_003099687.1.91392 WP_003099687.1.91416 WP_003099687.1.9143 WP_003099687.1.91431 WP_003099687.1.91438 WP_003099687.1.91467 WP_003099687.1.91527 WP_003099687.1.91563 WP_003099687.1.91585 WP_003099687.1.91796 WP_003099687.1.9182 WP_003099687.1.91838 WP_003099687.1.91846 WP_003099687.1.91860 WP_003099687.1.91862 WP_003099687.1.9191 WP_003099687.1.91938 WP_003099687.1.91943 WP_003099687.1.91996 WP_003099687.1.92043 WP_003099687.1.92175 WP_003099687.1.9219 WP_003099687.1.92314 WP_003099687.1.92321 WP_003099687.1.92357 WP_003099687.1.92573 WP_003099687.1.92585 WP_003099687.1.92587 WP_003099687.1.92589 WP_003099687.1.92594 WP_003099687.1.92624 WP_003099687.1.92630 WP_003099687.1.92642 WP_003099687.1.9272 WP_003099687.1.92759 WP_003099687.1.92769 WP_003099687.1.92839 WP_003099687.1.92847 WP_003099687.1.92894 WP_003099687.1.92924 WP_003099687.1.92930 WP_003099687.1.93001 WP_003099687.1.93090 WP_003099687.1.93122 WP_003099687.1.93130 WP_003099687.1.93144 WP_003099687.1.93148 WP_003099687.1.93250 WP_003099687.1.93264 WP_003099687.1.9328 WP_003099687.1.9349 WP_003099687.1.93493 WP_003099687.1.93498 WP_003099687.1.93547 WP_003099687.1.93562 WP_003099687.1.93568 WP_003099687.1.93797 WP_003099687.1.93848 WP_003099687.1.93889 WP_003099687.1.93897 WP_003099687.1.94004 WP_003099687.1.94031 WP_003099687.1.94065 WP_003099687.1.94078 WP_003099687.1.94136 WP_003099687.1.94174 WP_003099687.1.94211 WP_003099687.1.94218 WP_003099687.1.94221 WP_003099687.1.94230 WP_003099687.1.94243 WP_003099687.1.94285 WP_003099687.1.94333 WP_003099687.1.94349 WP_003099687.1.94385 WP_003099687.1.94434 WP_003099687.1.9444 WP_003099687.1.94450 WP_003099687.1.94682 WP_003099687.1.94742 WP_003099687.1.94814 WP_003099687.1.94818 WP_003099687.1.94856 WP_003099687.1.94874 WP_003099687.1.94896 WP_003099687.1.94897 WP_003099687.1.94943 WP_003099687.1.95018 WP_003099687.1.95025 WP_003099687.1.95027 WP_003099687.1.95056 WP_003099687.1.95117 WP_003099687.1.95132 WP_003099687.1.95187 WP_003099687.1.95207 WP_003099687.1.95217 WP_003099687.1.95305 WP_003099687.1.95324 WP_003099687.1.95354 WP_003099687.1.95359 WP_003099687.1.95460 WP_003099687.1.95488 WP_003099687.1.95525 WP_003099687.1.95536 WP_003099687.1.95638 WP_003099687.1.95668 WP_003099687.1.95745 WP_003099687.1.95751 WP_003099687.1.95774 WP_003099687.1.95782 WP_003099687.1.95787 WP_003099687.1.95802 WP_003099687.1.95820 WP_003099687.1.95825 WP_003099687.1.95959 WP_003099687.1.9599 WP_003099687.1.95994 WP_003099687.1.95999 WP_003099687.1.9604 WP_003099687.1.96041 WP_003099687.1.96058 WP_003099687.1.961 WP_003099687.1.96134 WP_003099687.1.96193 WP_003099687.1.96243 WP_003099687.1.96267 WP_003099687.1.96357 WP_003099687.1.96384 WP_003099687.1.96434 WP_003099687.1.96452 WP_003099687.1.96506 WP_003099687.1.96667 WP_003099687.1.96702 WP_003099687.1.96714 WP_003099687.1.96880 WP_003099687.1.96967 WP_003099687.1.9706 WP_003099687.1.97118 WP_003099687.1.97126 WP_003099687.1.97204 WP_003099687.1.97213 WP_003099687.1.9722 WP_003099687.1.97271 WP_003099687.1.97272 WP_003099687.1.97377 WP_003099687.1.97461 WP_003099687.1.97474 WP_003099687.1.97488 WP_003099687.1.97499 WP_003099687.1.97521 WP_003099687.1.97583 WP_003099687.1.97614 WP_003099687.1.977 WP_003099687.1.97826 WP_003099687.1.97877 WP_003099687.1.97968 WP_003099687.1.98111 WP_003099687.1.98260 WP_003099687.1.98276 WP_003099687.1.98308 WP_003099687.1.98410 WP_003099687.1.98414 WP_003099687.1.98433 WP_003099687.1.9845 WP_003099687.1.985 WP_003099687.1.98515 WP_003099687.1.98522 WP_003099687.1.98573 WP_003099687.1.98600 WP_003099687.1.98610 WP_003099687.1.98672 WP_003099687.1.98678 WP_003099687.1.98718 WP_003099687.1.98788 WP_003099687.1.98814 WP_003099687.1.9885 WP_003099687.1.98873 WP_003099687.1.98907 WP_003099687.1.98926 WP_003099687.1.98958 WP_003099687.1.98960 WP_003099687.1.98963 WP_003099687.1.99065 WP_003099687.1.99068 WP_003099687.1.99103 WP_003099687.1.99214 WP_003099687.1.99293 WP_003099687.1.99353 WP_003099687.1.99378 WP_003099687.1.99386 WP_003099687.1.99389 WP_003099687.1.99443 WP_003099687.1.99461 WP_003099687.1.9951 WP_003099687.1.99516 WP_003099687.1.99647 WP_003099687.1.99662 WP_003099687.1.99746 WP_003099687.1.99757 WP_003099687.1.99772 WP_003099687.1.99795 WP_003099687.1.99835 WP_003099687.1.9989 WP_003099687.1.99930 gi|558669365|ref|YP_008806075.1| gi|514412624|ref|YP_008136187.1| gi|392987251|ref|YP_006485838.1| gi|568157059|ref|YP_008946052.1| gi|116053678|ref|YP_794005.1| gi|478481987|ref|YP_007712638.1| gi|564955921|ref|YP_008888491.1| gi|568312988|ref|YP_008985257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]