SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C6FKE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C6FKE0
Domain Number 1 Region: 88-219
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.23e-20
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C6FKE0
Sequence length 225
Comment (tr|A0A0C6FKE0|A0A0C6FKE0_9RHIZ) Circadian phase modifier CpmA {ECO:0000313|EMBL:BAQ45604.1} KW=Complete proteome OX=270351 OS=Methylobacterium aquaticum. GN=Maq22A_c11765 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MSLSDEFTLDFARPERIGLEEAVFAAGKSPAQIDAILAAADERGARFLVTRLDPERHAAL
RYRDRLDYCAVSRTAFFGAARPVEGPARIAIVAAGTSDVPVAREAERTLAYQGHATTLIA
DVGVAGLWRLTRRVEEIRAHPIVICAAGMDAALPSVLGGLVAGAVIAVPTSVGYGVAEGG
RAALDAVLASCAPGIAVVNIDNGYGAACAALRLLHAANRLTESSR
Download sequence
Identical sequences A0A0C6FKE0 A0A1I1Y224
WP_060846908.1.69189 WP_060846908.1.79034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]