SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7AX29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7AX29
Domain Number 1 Region: 952-1065
Classification Level Classification E-value
Superfamily PX domain 3.4e-24
Family PX domain 0.00087
Further Details:      
 
Domain Number 2 Region: 456-598
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-24
Family Regulator of G-protein signaling, RGS 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C7AX29
Sequence length 1306
Comment (tr|A0A0C7AX29|A0A0C7AX29_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG63675.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_00783 OC=Rhizopodaceae; Rhizopus.
Sequence
MGGRMGFAVFFCICLSTIVCFGFNKTYLIYAISLPMVSLFALFSINTIVLYIYLKYIISA
RQHKVDNFKPLRLTHKAIWSSLEHSRHAESTQQHQEITTLDEVDTALDHLIQLVIRDFIQ
SWFQKIAAQEQSFSISVNHIIRSAAVQVSKRLQQIDLLHVLLNRVMPKVTSHISDFRAAE
ISLRGKYLERSVTESDELDLLLASQFRQGRLHAALTTGAVTTKPTEVAYLRQLMDRVLPL
IFNQKDTSSGLVHVVIREVVSCSILQPIMDMLADPDFWNQTIDTYLGKAIIEQQMVQQLR
EVLNRHSTNELDPEEEEEVMNFFDLSSKKAGLTSQISSTFLGVTQQDDALEGKQKRGTGR
RSFREFLKVIQEEQNLLELKRLRNDIVTQLRKKKAQIVDRDPEEIMDGERVQDIMVYINR
LSIAKKRVDKRIATLTGEEYNFKKSTSQLFSRKKSITTHSNNGYSLHDILTNTSGLSYFM
EFMDRQKDMVKLQFWLIVEGFKNTIDDQKTFLEDVKMVYETYFKDTAPHKLHIAEQLVAD
LRNAIELAETNGPSFDDNIRELRLKLYRMQQQIFWEIDKEHFPYFKRSDLYFKFLSSSTT
KEDSISPSRHSLDEGTLYSRPLPDDHRQKADSDSEISNKNMNASATASQSDLKLPMPEYG
RTRGHQRALSDSPRPLSGSRFLSLSSVFGSGLWNSERPQSATTDHDSVPSSVKSMEMADD
DEEEEEETVNPMNKRNKLIRSNTVDAVEAELRSILDSNNLEEVSTNNNSVDRNNEDTAQT
EQSTAKSLTSSTSASSILLLGNSKGVKSSTALPVQQIYTLPSWTSSGGTNTISEVEHNTL
ETVSRSPSVHTLETKKSEQEDEPVKNIHFAPPGDLLLEAKVEQLSKEIDKLTAQEAIVDA
LIEKAELQNKLEELRILKKSKSMFRQELQQMKYQKSQYELQETENTLVPNRSQVSITNAT
IGSDKHGDFALYVIEIQQLGCDGNYVSGWIVARRYSEFFSLHQKLKETYPAVKMIEFPAK
WPLLKLQKPFLEARRVSLERYLRRLVDDEEICKSQELRAFLSQQNIFIPGPADQLGTPSS
SPSVQNLQKSIIALGEQEKHALQKKPSKGFMRHIYKTVAAGIDDILIAPSMLDLITQRLG
EQVTEFSHEDNHSTKTTASTSSSVVSINSGKLADSALQASTTSLPDSIKAEGITRFTEPL
CDLFIEMFELKDKTNWLRRQAIVIIIQQILEGTIERKLREIVKSLSSSSMVVSYINKVAD
SLWPNGGPITFKEPRKPEEKVQAKEEANRKLSTWLPGKEARLLRFY
Download sequence
Identical sequences A0A0C7AX29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]