SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7BQB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7BQB8
Domain Number 1 Region: 155-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.52e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.039
Further Details:      
 
Domain Number 2 Region: 27-142
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000523
Family Regulator of G-protein signaling, RGS 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C7BQB8
Sequence length 511
Comment (tr|A0A0C7BQB8|A0A0C7BQB8_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG73475.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_08850 OC=Rhizopodaceae; Rhizopus.
Sequence
MDKLKQSSHRSTESYASITPSVLSTITFHDVLKDPTLLHSFEYYLKKNWSQEYLLFIEAV
NQLRHESNRPKDIEDTLFRIYHNFIEPGSPMELNVSTKQEVKEKLNSLQWAVITRDDAVD
VLNNTEQEVLASLHVKFSEFLGTSLAASSSLQSKLYKEPTKDQKRVVIIGGGFTGFTVAS
ILDPMSRFHVTLIDAKDSFEYTPGIVSKIVNPERSTSLRFTHESYVKNGKVVIGYASDIL
NDAKSVKVNDEVIHFDYLVLCTGTSYANQLKSTDSSSLYRTANLRKISREITQAKKVLIV
GAGLVGCELAAAIRQKSLAAQRDTKVVLVDSLSEVLHRFPLKQKRKAHEFLVNLGVDIVL
NERITAIGSDENDEAYYGSSGRIYSRKEHVVLLATGVKVNTDILLNSTNESCLDICLDNR
GYVRVKPTLQIEHWKYNHIFAGGDITNVIEEKTAYAATIAGVCIARNICRLEKGKDPLAQ
GTKGLIAPPTKPLHGVSSQGGIGKRKSFDFI
Download sequence
Identical sequences A0A0C7BQB8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]