SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7BUC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7BUC6
Domain Number 1 Region: 413-505,567-597
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-17
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 
Domain Number 2 Region: 223-307
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000147
Family DEP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7BUC6
Sequence length 642
Comment (tr|A0A0C7BUC6|A0A0C7BUC6_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG74834.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_09972 OC=Rhizopodaceae; Rhizopus.
Sequence
MPKTLNSSFATYTTMMRITKKGRPFTKDLYDMFSAVLLQIELTDHRTFFRTYPYTFTTDE
AIKVMSSLQFIHVHRQPDPSDPSRQISTRTTTTFSMDTTTAKNMIQYFLSARLIMNATDP
NNWTVKDKGLWCPTLKGKYILEEFADYTQVEMKNSLIAALNAPYMVPSVSGSTGGRIIKL
DRLTDHDDQITFSRANMTIAFKAMLASLPLDALVLDDVGGIDRKNLSRYQHTFLGTQCVE
WLADRLTVSSKEEAEMVASEFVLFGWIGLVVDKSDKSFCVNEDGISFKTSRFAIYYVTER
GLIIAGWKPSQEEAIQQASDISFTSETSSSSKSSMIKQRPSPQSSVSRSHRHVDEEGPSS
AAMSRSSSLGDASEQLATMSISKEGAPLRPPSMSLTDSSMSHGSVASKDTSQYTRLHHIL
DTPLLRMYFRDFLRANYCEENINYWVDHDRLIRNYKLGTLSALDQLAECYAVYEMYLSPD
AKADVNIDHMLHREILNFINSVFVPVPHLPSNTKVPYFTTLPATTVTKPLGPCDRLLLLP
PQVSAKQRTIVIRGLSPDRCLTKLLGILSRVNDHLCKMMAEDSVPKFIKTRRYKDLMIHQ
QSLSPKEQAIENSQIEILTALSSSTTPPQRLSLDEQRHEIQA
Download sequence
Identical sequences A0A0C7BUC6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]