SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7C527 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7C527
Domain Number 1 Region: 135-267
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-34
Family cAMP-binding domain 0.0000208
Further Details:      
 
Domain Number 2 Region: 11-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000186
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7C527
Sequence length 524
Comment (tr|A0A0C7C527|A0A0C7C527_9FUNG) Putative cAMP-dependent protein kinase regulatory subunit {ECO:0000313|EMBL:CEG78519.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_13115 OC=Rhizopodaceae; Rhizopus.
Sequence
MESFQFSSYADEYTQLLTELHEAYCKDQPEDVLQYCSNFFNKKLEEQRSMYFRQQHNPFL
ETERHPLADTDDYPTRDRAYSSFTVTTTTTSIDGELDDNFSIEPLSMQPNYNRGRRTSVS
AESMAPAGNKFVKKIIPKTEAQMERIRNSVGNNFLFKNLDEEHHQDVVNAMMEMTIEEGK
TIIEQGAVGDYFYIVDSGTFDCFITKDGKTNKVTSYETGGSFGELALMYNAPRAATIVAT
SDAKVWALDRVTFRTILMENTSLKRKMYESFLAEVPLLKSLESYERHKIADALESVYFQD
KEQIADTSVNPEPSSSNSTSGSASPRYSSLVPTSVMVKRSTSPKSVASGSHGNTCPLEKK
VQEQELHISQMKTQLSQMNAKMESVESMVNLFKRALEDMQLDVHRHRHMFQEEQGLRRHT
QNRLSSIELDVVQMLAEKEQLLAEIHDLTRDEEHSGEAEKCRVCFNRPVEYVLLPCFHFA
YCEMCSSRLTECAQLEIQSERIKELQFEIESYYTQRDSPRSVRK
Download sequence
Identical sequences A0A0C7C527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]