SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7C9E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7C9E9
Domain Number 1 Region: 10-165
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.45e-24
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.065
Further Details:      
 
Domain Number 2 Region: 154-275
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000000000011
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C7C9E9
Sequence length 281
Comment (tr|A0A0C7C9E9|A0A0C7C9E9_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG79979.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_14380 OC=Rhizopodaceae; Rhizopus.
Sequence
MDAPWSSPKTLSTTDGISRLSQEILDFEKYIAPTDREQRLRSDALNMIQWLIESMFSPMP
VVEAFGSFVTSLALPSSDVDIVIRFDKPVMPRNILNKIYREAKRRIMFKRSEFIRAAKTP
IITGRLSNGVSVDISVQGNVTSSERTVTWIKEYPELKPLFMVLKQSLSAFRLRNVWTFEP
LSAKTAGLCNFGLICLIVSYLQLHKPTDITSTDPQYYGRLLLGLLDYYAHDFDASKHIIS
VSDEGKYYPMREMNKVLGDYYYESGKLFIINPDEPGLYMQN
Download sequence
Identical sequences A0A0C7C9E9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]