SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7CFF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7CFF0
Domain Number 1 Region: 53-204
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 5.89e-33
Family Poly(A) polymerase, PAP, C-terminal domain 0.00053
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000000000863
Family Poly(A) polymerase, PAP, middle domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C7CFF0
Sequence length 254
Comment (tr|A0A0C7CFF0|A0A0C7CFF0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG82026.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_16157 OC=Rhizopodaceae; Rhizopus.
Sequence
MPIITPSYPSMCATHNVTPSTQRIIIGELKQAAEMVEKIIAGSATWSQLFQPHRFFGMYH
QYLQITVIADDYNLQLKWAGLVEARIRQFVIKLEAVPPILLVHPFVDGFSENHICNSASD
VSAMSLGRKPDNKNNDTVSGKMIYSKTFYIGLYIRRAGKAQLTIDICVPIEEFKNTLRLW
PEYNSRHMAVHVEAIHQSDLPRDLLTKSNPAGKRTLKPSTSTSNSNTVTNKKSKRNNEAN
NELPVTATTATVAL
Download sequence
Identical sequences A0A0C7CFF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]