SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7CGK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7CGK2
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 8.04e-24
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7CGK2
Sequence length 197
Comment (tr|A0A0C7CGK2|A0A0C7CGK2_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG82048.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_16178 OC=Rhizopodaceae; Rhizopus.
Sequence
MLHDYPAACPLTLLVKHFLSLYEPSEVFTGGLGGYAIVCMVVSFLQRHPKVATRQIDPMR
NLAPLFSDFLQLYGSKFNIDDVGIDVQGEGEYFRKYENWKTYTIIDPQDSSNDLGLKSFK
SKTVAKNFHYGYVSIYRKACILNARLKQHNYNYASAFSNYSLYGKSLLAACMYIHPETVQ
HREHMRRVYDDLITLSE
Download sequence
Identical sequences A0A0C7CGK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]