SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7DUJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7DUJ1
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 9.02e-24
Family N-utilization substance G protein NusG, N-terminal domain 0.0006
Further Details:      
 
Domain Number 2 Region: 118-170
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.63e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7DUJ1
Sequence length 174
Comment (tr|A0A0C7DUJ1|A0A0C7DUJ1_9GAMM) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=91844 OS=Candidatus Portiera aleyrodidarum. GN=PLF_150 OC=Candidatus Portiera.
Sequence
MKKKLYVIHIYSGSEKKVIIDLKNRIKLSRLEKYFGKMIAPSDIKIENISGKLRKIERKY
YPGYLLIEMVLNDKTWNLVNETKRVVRFIGANAIKPEFIKKNELINILKNIKKGIENHSF
NLGERVRVIEGPFTDFTGIIEEINYEKKKIQVSVLIFGRSTPVELDFHKVIKEN
Download sequence
Identical sequences A0A0C7DUJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]