SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7G5X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7G5X1
Domain Number 1 Region: 23-82,148-211
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000392
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7G5X1
Sequence length 281
Comment (tr|A0A0C7G5X1|A0A0C7G5X1_PAESO) Uncharacterized protein {ECO:0000313|EMBL:CEQ03455.1} KW=Complete proteome OX=1505 OS=Paeniclostridium sordellii (Clostridium sordellii). GN=R28058_11881 OC=Peptostreptococcaceae; Paeniclostridium.
Sequence
MTRLNIIKNKLEKLKNFDKNYCVFGSINHKYKLNNTLSKSELKQFGKINNITLPEEYANF
LLEIGNGGAGPGYGIIGITPKQLTKRYYRFSYTFRFSGDFVPNTYNHCTMIEDDDLSCED
CDKRFSCVDAFYEDDFECEDDYISGYLDGTLNINNMGCGLESRLILNGPEFGNVWINDPD
QLFTPRRTLTKDRLSFYDWYENWLDSQLSKFELIKSLFDKKVPYEEFFNTSISDFEVEEI
IATFLGLLLIKINPSNYESSKFSLRELNVDLEKEYIRYIKQ
Download sequence
Identical sequences A0A0C7G5X1
WP_055341779.1.8285 WP_055341779.1.90398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]