SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7N5C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7N5C4
Domain Number 1 Region: 87-165,253-317
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000283
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C7N5C4
Sequence length 527
Comment (tr|A0A0C7N5C4|A0A0C7N5C4_9SACH) LALA0S07e03114g1_1 {ECO:0000313|EMBL:CEP63133.1} KW=Complete proteome; Reference proteome OX=1245769 OS=Lachancea lanzarotensis. GN=LALA0_S07e03114g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MQNFKKKWKELVYSFSTEDRYADYNGKTNDSVVPSRPESSVANAAASSSQIQLTDFTDGP
VGGTNDGVSEAMLAWRHIDAWASEHHSDLFATLSEPCTRTDISRAEADLKIVFPASIRAS
FRLHDGQEGLESLTGTSGLLFGLQLMPLDQVVHMTQTWRNVAANMAKHNRSLSPTTTNST
ASGSNVEAPNKAATPQNLKTKGYGKLDTQDFQSMNPTLQRDISHNNNKQFKLNSIPRQDS
VPPEATQSVYASQGWIPLVTDNAGNHIAVDLSPGPKGHYGQIILFGREFDIKYVVARNWG
DFLLSFANDLEKGNWYIMDGDDDYLSGAGELVFRDKNAGNTVRDYFEVLKSRSRETWQKT
TTAAKDVNEKLSAVPSAAQGKNLTSQTLLSSPSLLEQETTAVTETEGTEEVKEAEKKIEN
SNVREASVDSTQASLSSEDASKTKQSVQQTATAMVSKDEPSADNIESGATGSEKSKVQSE
NKTEAHKEAPAPKDQDEEGQTLSSEPQQSSKKDDVQNLKEEFENVAL
Download sequence
Identical sequences A0A0C7N5C4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]